Protein Sequence for fig|426430.8.peg.2508 from Staphylococcus aureus subsp. aureus str. Newman

>fig|426430.8.peg.2508 FIG01108752: hypothetical protein
MVKKINELLKSIDRNGALEGIGKPEKLKSNLTGYYSRRINHEHRLVYTVDDNHIKIASCK
YHY