Protein Sequence for fig|426430.8.peg.2506 from Staphylococcus aureus subsp. aureus str. Newman

>fig|426430.8.peg.2506 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
MTIKVEDNKIIFSRTIEAPIEKVFDAYTTKALFEKWFHPKDASTKVFRFNAVSGGDAFYA
IKTPTMTSYTLAEYKTVKRPYLIEYIDSFATPQGAKDTKMPSMKITLSFSKSNTTKTTVT
STSVFPTKEAAQQVINMGVEQGMNQTLDQLDALLK