Protein Sequence for fig|426430.8.peg.2362 from Staphylococcus aureus subsp. aureus str. Newman

>fig|426430.8.peg.2362 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
MKQFEIVTEPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKL
AQIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVP
IWKKEIWEDGSKWQGHQKGNYEEAKREE