Protein Sequence for fig|426430.8.peg.2186 from Staphylococcus aureus subsp. aureus str. Newman

>fig|426430.8.peg.2186 SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
MKKTLLASSLAVGLGIVAGNAGHEAHASEADLNKASLAQMAQSNDQTLNQKPIEAGAYNY
TFDYEGFTYHFESDGTHFAWNYHATGTNGADMSAQAPATNNVAPSAVQANQVQSQEVEAP
QNAQTQQPQASTSNNSQVTATPTESKSSEGSSVNVNAHLKQIAQRESGGNIHAVNPTSGA
AGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGAGHWVTA