Protein Sequence for fig|426430.8.peg.2020 from Staphylococcus aureus subsp. aureus str. Newman

>fig|426430.8.peg.2020 Manganese-dependent inorganic pyrophosphatase (EC 3.6.1.1)
MAKTYIFGHKNPDTDAISSAIIMAEFEQLRGNSGAKAYRLGDVSAETQFALDTFNVPAPE
LLTDDLDGQDVILVDHNEFQQSSDTIASATIKHVIDHHRIANFETAGPLCYRAEPVGCTA
TILYKMFRERGFEIKPEIAGLMLSAIISDSLLFKSPTCTQQDVKAAEELKDIAKVDIQKY
GLDMLKAGASTTDKSVEFLLNMDAKSFTMGDYVTRIAQVNAVDLDEVLNRKEDLEKEMLA
VSAQEKYDLFVLVVTDIINSDSKILVVGAEKDKVGEAFNVQLEDDMAFLSGVVSRKKQIV
PQITEALTK