Protein Sequence for fig|426430.8.peg.1980 from Staphylococcus aureus subsp. aureus str. Newman

>fig|426430.8.peg.1980 Two component transcriptional regulator VraR
MTIKVLFVDDHEMVRIGISSYLSTQSDIEVVGEGASGKEAIAKAHELKPDLILMDLLMDD
MDGVEATTQIKKDLPQIKVLMLTSFIEDKEVYRALDAGVDSYILKTTSAKDIADAVRKTS
RGESVFEPEVLVKMRNRMKKRAELYEMLTEREMEILLLIAKGYSNQEIASASHITIKTVK
THVSNILSKLEVQDRTQAVIYAFQHNLIQ