Protein Sequence for fig|426430.8.peg.1948 from Staphylococcus aureus subsp. aureus str. Newman

>fig|426430.8.peg.1948 Phage phi 11 orf22 protein homolog
MTDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGAYYFHGHIVPDWQGVKKTFDTAEEL
GIYIKQHGLEYEEQKQLTLF