Protein Sequence for fig|426430.8.peg.1520 from Staphylococcus aureus subsp. aureus str. Newman

>fig|426430.8.peg.1520 FIG01107889: hypothetical protein
MFKRTKLILIATLLLSGCSTTNNESNKETKSVPEEMEASKYVGQGFQPPAEKDVVEFAKK
HKDKIAKRGEQFFMDNFGLKVKATNVVGSGKGVEVFVHCDDHDIVFNASIPFDKSIIESD
SSLRSEDKGDDMSTLVGTVLSGFEYRTQKEKYDNLYKFFKDNEEKYQYTGFTKEAINKTQ
NVGYKNEYFYITYSSRSLKEYRKYYEPLIHKNDKEFKEGMEQARKEVNYAANTDTVTTLF
STKENFTKDNTVDDVIELSDKLYNFKNKPEKSTITIQIGKPTINTKKAFYDDNDPIEYGV
YRKDE