Protein Sequence for fig|426430.8.peg.1252 from Staphylococcus aureus subsp. aureus str. Newman

>fig|426430.8.peg.1252 Signal recognition particle associated protein
MGQNDLVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIR
RTGDLVEDYEKKLELYQKFEQRREIYDEMKQHLSNPEQIQRYIQQLEDLE