Protein Sequence for fig|426430.8.peg.1125 from Staphylococcus aureus subsp. aureus str. Newman

>fig|426430.8.peg.1125 Phage phi 11 orf43 protein homolog
MDIELTKKDGTVIKLSEYGFIVNDIVIDSMQINTKYQDKENMNGRILMGSNYISRDIVVP
CFCVVKNRSDIAYMRDMLYSLTTDIEPMYLREIRRKEELNYRFTQPISDDYVKLDKNNFP
DYEYSRHDQQIYVNGKQYKVIFNGVINPKQKGNKVSFELKFETTELPYGESIGTSLELEE
NKKVGLWSFDFNIDWHAGGDKRKYTFENLSKGTVYYHGSAPNDQFNMYKKITIILGEDTE
SFVWNLTHAEIMKIEGIKLKAGDRIVYDSFRVYKNGVEISTETNIAQPKFKYGANKFEFN
QTVQKVQFDLKFYYK