Protein Sequence for fig|426430.8.peg.1086 from Staphylococcus aureus subsp. aureus str. Newman

>fig|426430.8.peg.1086 Phage phi 11 orf11 protein homolog
MYYKAGDVCRKIFNVDGFDFQLRVKKRAYSVEIVVLDHEGNSIDGLLVSDENDLYTALDI
LKQSIYEWIENNTDEQDRLINLVMKW