Protein Sequence for fig|349106.5.peg.813 from Psychrobacter sp. PRwf-1

>fig|349106.5.peg.813 Tryptophan synthase beta chain (EC 4.2.1.20)
MKKIMTTFDNIPHNDEIDDIQDFNQYPDASGHFGIHGGRFVSETLMAALEELETLYYQVK
QDPAFWQEYHNDLVNYVGRPTPLYHAKRLSDEIGGAQIYFKREDLNHTGAHKVNNTIGQA
LLAKMSGKKRIIAETGAGQHGVATATIAARLGLECIIYMGADDVERQKMNVYRMRLLGAK
VVAVESGSRTLKDAMNEAMRDWVTNVDTTYYIIGTVAGPHPYPLLVRDFQAIIGKEARLQ
HLEKTGKLPDALVACVGGGSNAIGLFYEFLNDTDVKMYGVEATGDGIETGRHSAPLAAGR
VGVLHGNRTYLMADDDGQILETHSISAGLDYPGVGPEHSFLKDVKRVEYVGCTDKEALHG
FHEVTRKEGIIPALESSHAVAYALQLAKTMSPEQSIIVNMSGRGDKDLHSVMKAEGIEL