Protein Sequence for fig|321314.4.peg.3594 from Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67

>fig|321314.4.peg.3594 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
MHITYDLPVAIEDILEAKKRLAGKIYKTGMPRSNYFSERCKGEIFLKFENMQRTGSFKIR
GAFNKLSSLTEAEKRKGVVACSAGNHAQGVSLSCAMLGIDGKVVMLKGAPKSKVAATCDY
SAEVVLHGDNFNDTIAKVSEIVETEGRIFIPPYDDPKVIAGQGTIGLEIMEDLYDVDNVI
VPIGGGGLIAGIAIAIKSINPTIKVIGVQAENVHGMAASYYAGEITTHRTTGTLADGCDV
SRPGNLTYEIVRELVDDIVLVSEDEIRNSMIALIQRNKVITEGAGALACAALLSGKLDSH
IQNRKTVSIISGGNIDLSRVSQITGLVDA