Protein Sequence for fig|314260.3.peg.1296 from Parvularcula bermudensis HTCC2503

>fig|314260.3.peg.1296 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
MPLSSDPEPAVRGEAAAPSPRAAFSLSDQEWRAIVDKTDPAWQEIRETPCLPSRKLGALT
NCRLWLKYENLQYIGAFKERGALAKLLSLSDAERQSGVVAASAGNHAQGLARHAELLGIR
ATIVMPAQTPSVKVEETKRFGAEVILHGTDFEAAHAEAIRQVEEEGKTLVHPFDDPYVAA
GQGTIAKEMLCEAPEIDTLVIPIGGGGLIAGMAAVAKEMRPDIRIIGVQAALYPGMANAV
RNESAPCGGMTLAEGIAVCDPGRFTREVVARLVDEIVTVDERALERSLSLLLMTQKTLAE
GAGAAGLAALLAHPHLFEGHAVGTIVCGGNIDPRLLSSILMRDLARQRRLARLRVPLMDV
PGQLTRVSAAIGAAGGNVIDVSYHKVFNDLPAKQTHLDISVEATGPAHMDRIVEALRAEG
LEPEVANY