Protein Sequence for fig|158879.11.peg.845 from Staphylococcus aureus subsp. aureus N315

>fig|158879.11.peg.845 Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
MVKIVVSRKIPDKFYQQLSKLGDVVMWQKSLVPMPKDQFVTALRDADACFITLSEQIDAE
ILAQSPNLKVIANMAVGYDNIDVESATANNVVVTNTPNVLTETTAELGFTLMLAIARRIV
EAEKYVEADAWQSWGPYLLSGKDVFNSTIGIYGMGDIGKAFARRLQGFNTNILYHNRSRH
KDAEADFNATYVSFETLLAESDFIICTAPLTKETHHKFNAEAFEQMKNDAIFINIGRGQI
VDETALIDALDNKEILACGLDVLANEPIDHTHPLMGRDNVLITPHIGSASVTTRDNMIQL
CINNIEAVMTNQVPHTPVN