Protein Sequence for fig|158879.11.peg.753 from Staphylococcus aureus subsp. aureus N315

>fig|158879.11.peg.753 Excinuclease ABC subunit A
MKEPSIVVKGARAHNLKDIDIELPKNKLIVMTGLSGSGKSSLAFDTIYAEGQRRYVESLS
AYARQFLGQMDKPDVDTIEGLSPAISIDQKTTSKNPRSTVATVTEIYDYIRLLYARVGKP
YCPNHNIEIESQTVQQMVDRIMELEARTKIQLLAPVIAHRKGSHEKLIEDIGKKGYVRLR
IDGEIVDVNDVPTLDKNKNHTIEVVVDRLVVKDGIETRLADSIETALELSEGQLTVDVID
GEDLKFSESHACPICGFSIGELEPRMFSFNSPFGACPTCDGLGQKLTVDVDLVVPDKDKT
LNEGAIEPWIPTSSDFYPTLLKRVCEVYKINMDKPFKKLTERQRDILLYGSGDKEIEFTF
TQRQGGTRKRTMVFEGVVPNISRRFHESPSEYTREMMSKYMTELPCETCHGKRLSREALS
VYVGGLNIGEVVEYSISQALNYYKNIDLSEQDQAIANQILKEIISRLTFLNNVGLEYLTL
NRASGTLSGGEAQRIRLATQIGSRLTGVLYVLDEPSIGLHQRDNDRLINTLKEMRDLGNT
LIVVEHDDDTMRAADYLVDIGPGAGEHGGQIVSSGTPQKVMKDKKSLTGQYLSGKKRIDV
PEYRRPASDRKISIRGARSNNLKGIDVDIPLSIMTVVTGVSGSGKSSLVNEVLYKSLAQK
INKSKVKPGLYDKIEGIDQLDKIIDIDQSPIGRTPRSNPATYTGVFDDIRDVFAQTNEAK
IRGYQKGRFSFNVKGGRCEACKGDGIIKIEMHFLPDVYVPCEVCDGKRYNRETLEVTYKG
KNIADILEMTVEEATQFFENIPKIKRKLQTLVDVGLGYVTLGQQATTLSGGEAQRVKLAS
ELHKRSTGKSIYILDELTTGLHVDDISRLLKVLNRLVENGDTVVIIEHNLDVIKTADYII
DLGPEGGSGGGTIVATGTPEDIAQTKSSYTGKYLKEVLERDKQNTEDK