Protein Sequence for fig|158879.11.peg.744 from Staphylococcus aureus subsp. aureus N315

>fig|158879.11.peg.744 ComF operon protein A, DNA transporter ATPase
MDNVTRYKITESSQSSSQAYYHLSFELSEQQSYASEHIVRAIRMRQTILLYAVTGAGKTE
MMFQGIQYARRQGDNIAIVSPRVDVVVEISKRIKDAFLNEDIDILHQQSSQQFEGHFVVC
TVHQLYRFKQHFDTIFIDEVDAFPLSMDKSLQQALKSSSKVEHATIYMTATPPKQLLSEI
PHENIIKLPARFHKKSLPVPKYRYFKLNNNKIQKMLYRILQDQINNQRYTLVFFNNIETM
IKTFSVYKQKITKLTYVHSEDVFRFEKVEQLRNGHFDVIFTTTILERGFTMANLDVVVID
AHQYTQEALIQIAGRVGRKLECPAGKVLFFHEGVSMNMIQAKKEIQRMNKLALKRGWIDE