Protein Sequence for fig|158879.11.peg.650 from Staphylococcus aureus subsp. aureus N315

>fig|158879.11.peg.650 Probable low-affinity inorganic phosphate transporter
MSYIIIVTIAVVIFSLIFDFINGFHDTANAVATAVSTRALTPKTAILMAAVMNFIGALTF
TGVAGTITKDIVDPFKLENGLVVVLAAILAAIIWNLATWFYGIPSSSSHALIGSIAGAAI
ASEGSFGVLHYQGFTKIIIVLIVSPIIAFCVGFLMYSIFKVIFKNANLTRANRNFRFFQI
FTAALQSFSHGTNDAQKSMGIITLALIVANVQNDGSVEPQLWVKFACATAMGLGTAIGGW
KIIKTVGGNIMKIRPANGAAADLSSALTIFVASSLHFPLSTTHVVSSSILGVGASNRAKG
VKWSTAQRMIITWVITLPISALLAGLLFYILNLFF