Protein Sequence for fig|158879.11.peg.342 from Staphylococcus aureus subsp. aureus N315

>fig|158879.11.peg.342 Luciferase-like monooxygenase YhbW
MAKLEMNKNTPLEFGLYSLGDHLLNPFKGEKVSYEQRINEIIEASKLADETGIDVFAVGE
SHQEHFTTQAHTVVLGAIAQATKHIKVSSSSTIISATDPVRVFEDFATLDLISHGRAEIV
AGRASRTGIFDLFGYDLKDYDELFEEKLGLLLELNKTERITWSGKYRPELRNMKIFPRPI
DNILPIWRAVGGPPASAIKAGKQGVPMMITTLGGPAMNFKGSIDAYRQAATEAGFDASHK
SLPVSTASLFYTAETTQDAMREFYPHLNTGMSFIRGVGYPKQQFANSSDYREALMVGSPQ
QIIEKILYQHELYGHQRFMAQLDFGGVPFENVMKNIELIGNEIIPAIKKHLSK