Protein Sequence for fig|158879.11.peg.2704 from Staphylococcus aureus subsp. aureus N315

>fig|158879.11.peg.2704 Chromosome (plasmid) partitioning protein ParB-2
MKKPFSKLFGLKNKDDIIGHIEEDRNSNVESIQIERIVPNRYQPRQVFEPNKIKELAESI
HEHGLLQPIVVRPIEEDMFEIIAGERRFRAIQSLNLPQADVIIRDMDDEETAVVALIENI
QRENLSVVEEAEAYKKLLEIGDTTQSELAKSLGKSQSFIANKLRLLKLAPKVLLRLREGK
ITERHARAVLSLSDSEQEALIEQVIAQKLNVKQTEDRVRQKTGPEKVKAQNLRFAQDVTQ
ARDEVGKSIQAIQQTGLHVEHKDKDHEDYYEIKIRIYKR