Protein Sequence for fig|158879.11.peg.2688 from Staphylococcus aureus subsp. aureus N315

>fig|158879.11.peg.2688 Transcriptional regulator, PadR family
MSVSDQIMKGLLDGAILGLIAQGETYGYEIMTKLKNQEFPEISEGSIYPVLMRLNKKGYV
DTTIKKSSNGGPRRKYYTITDSGLKELKVFKSKWQALNKGMINLFGGENDVN