Protein Sequence for fig|158879.11.peg.2584 from Staphylococcus aureus subsp. aureus N315

>fig|158879.11.peg.2584 Mobile element protein
MNTIESQFDKVAEDYDFVNELLNDYSFFVSNMSPKKGRALDIGCGSGLLVEKLASYYDEV
VGIDISNQMLDLAKSKRQLTNTVYLNMNAEQLNFNEKFDFIVSRTTFHHLDDIASVIQQM
KELLNEEGRIVILDNVSEVETPPTYVYKLGAIQEFLPHCFKFGIKNAIRIYNHNTSKSWL
EHLASDKYLSEQNYYDLYEKLLPGCQFHKMGWAMGVVWTK