Protein Sequence for fig|158879.11.peg.2021 from Staphylococcus aureus subsp. aureus N315

>fig|158879.11.peg.2021 Transcription accessory protein (S1 RNA-binding domain)
MDNQLINSIIEKYQFSKKQIEAVLTLLEEKNTVPFIARYRKEQTGGLDEVQIKQIDDEYQ
YMVNLQKRKEEVIKNIEQQGLLTEELKKDILKQNKLQRVEDLYRPFKQKKKTRATEAKRK
GLEPLAIWMKARKHEVSIEEKAQQFINEEVQSVEDAIKGAQDIIAEQISDNPKYRTKILK
DMYHQGVLTTSKKKNAEDEKGIFEMYYAYSEPIKRIANHRVLAVNRGEKEKVLSVKFEFD
TTSVEDFIARQEINHNNVNRSYILEAIKDSLKRLIVPSIEREIHADLTEKAENHAIDVFS
ENLRNLLLQPPMKGKQILGVDPAFRTGCKLAVINPFGTFIAKGVIYPHPPVSKKEAAEKD
FVQMVKAYDVQLIAIGNGTASRETEQFVADLIKKHQLPVQFIIVNEAGASVYSASEIARD
EFPDFQVEERSAVSIGRRVQDPLSELVKIDPKSIGVGQYQHDVNQKALENALTFVVETAV
NQVGVDVNTASSSLLQYVSGLSSQIAKNIIAYREENGAIKHNKELSKIKRLGAKTFEQSI
GFLRIVDGSEPLDNTSIHPESYKVTYQLLDKLGFGGNDLGSDALKAKLNSLDMDELAIEL
QVGVPTLEDIIKSLKAPNRDPRDEFDTPILKSDVLSIEDLKEGMKLSGTVRNVVDFGAFV
DIGVKQDGLVHVSKLSKKFVKNPMDIVSVGDIVDVWVYSIDKNKDKVSLTMIDPHE