Protein Sequence for fig|158879.11.peg.1022 from Staphylococcus aureus subsp. aureus N315

>fig|158879.11.peg.1022 DUF1054 superfamily protein
MTKYTFKPKDFKAFNVEGLDARMEALNEYIRPQLHELGEYFSDFFTSQTGETFYPHVAKH
ARRSVNAPKDTWVAFATSKRGYKMLPHFQIGMFEDQLFVMFGIMHEAKDKATRAKVFERK
FKAIQQLPDDYRVCLDHMKPDKPFIKDLTDDDLKEAIQRAINVKKGEFFIARAITPQDKR
LKSDKAFIAFLEETFDQFLPFYSA