Protein Sequence for fig|158879.11.peg.1016 from Staphylococcus aureus subsp. aureus N315

>fig|158879.11.peg.1016 Spermidine/putrescine import ABC transporter, permease subunit PotB
MRNTNKFLLIPYLLWMVIFIIVPVVLLIYFSFLDINGHFSFTNYQQIFTTKYLKMFAYSI
LYAALITIITLAISYPAAYYITRSKFQNILLMIMIIPTWINLLLKTYAFIGLLSHDGVIN
QFFHLFNLPSFNLLFTTGAFLVVASYIYIPFMILPIFNSMKAIPNNLLQASSDLGASPFY
TFRKVIMPLTKEGVMTGIQVTFIPSLSLFMITRLIAGNKVINIGTAIEEQFLTIQNYGMG
STIAIFLIVFMAFILIITKSSNGRG