Protein Sequence for fig|1158485.3.peg.1787 from Staphylococcus aureus M1311

>fig|1158485.3.peg.1787 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
MTTNTVTLQTAHIVSLGDIEEAKASIKPFIRRTPLIKSMYLSQSITKGNVFLKLENMQFT
GSFKFRGASNKINHLTDEQKEKGIIAASAGNHAQGVALTAKLLGINATIVMPETAPQAKQ
QATKGYGAQVILKGKNFNETRLYMEELAKENGMTIVHPYDDKFVMAGQGTIGLEILDDIW
NVNTVIVPVGGGGLIAGIATALKSFNPSIHIIGVQSENVHGMAESFYKRDLTEHRDDSTI
ADGCDVKVPGEQTYEVVKHLVDEFILVTEEEIEHAMKDLMQRAKIITEGAGALPTAAILS
GKIDKKWLEDKNVVALVSGGNVDLTRVSGVIEHGLNIADTSKGVVG