Protein Sequence for fig|1116050.3.peg.3555 from Escherichia coli P0299917.4

>fig|1116050.3.peg.3555 Threonine catabolic operon transcriptional activator TdcR
MTGITIFYGDNIIRYVVNIKKGLRPYFKQLPDNYQAKFELNLMSKFSNFIINKPFSAINT
AARHIFSRYLLENKHLFYQYFKISNTGIDHLEQLINVNFFSSDRTSFCECNRFP