Protein Sequence for fig|1116050.3.peg.3551 from Escherichia coli P0299917.4

>fig|1116050.3.peg.3551 Acetate kinase (EC 2.7.2.1) @ Propionate kinase (EC 2.7.2.15)
MNEFPVVLVINCGSSSIKFSVLDASDCEVLMSGIADGINSENAFLSVNGGEPAPLAHHSY
EGALKAIAFELEKRNLNDSVALIGHRIAHGGSIFTESAIITDEVIDNIRRVSPLAPLHNY
ANLSGIESAQQLFPGVTQVAVFDTSFHQTMAPEAYLYGLPWKYYEELGVRRYGFHGTSHR
YVSQRAHSLLNLAEDDSGLVVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDV
DFGAMSWVASQTNQSLGDLERVVNKESGLLGISGLSSDLRVLEKAWHEGHERAQLAIKTF
VHRIARHIAGHAASLRRLDGIIFTGGIGENSSLIRRLVMEHLAVLGVEIDTEMNNRSNSC
GERIVSSENARVICAVIPTNEEKMIALDAIHLGKVNAPAEFA