Protein Sequence for fig|1116050.3.peg.3549 from Escherichia coli P0299917.4

>fig|1116050.3.peg.3549 2-iminobutanoate/2-iminopropanoate deaminase RidA/TdcF (EC 3.5.99.10)
MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAI
VVAAGLSVGDIIKMTVFITDLNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLE
IEAIAVRSA