Protein Sequence for fig|1081887.3.peg.4542 from Escherichia coli 09BKT078844

>fig|1081887.3.peg.4542 Acetolactate synthase small subunit (EC 2.2.1.6)
MQNTTHDNVILELTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQDSDKSHIWLLVNDDQ
RLEQMISQIDKLEDVVKVQRNQSDPTMFNKIAVFFQ