Protein Sequence for fig|1005403.3.peg.4124 from Escherichia coli 93.0055

>fig|1005403.3.peg.4124 Branched-chain amino acid ABC transporter, ATP-binding protein LivF
MEKVMLSFDKVSAHYGKIQALHEVSLHINQGEIVTLIGANGAGKTTLLGTLCGDPRATSG
RIVFDDKDITDWQTAKIMREAVAIVPEGRRVFSRMTVEENLAMGGFFAERDQFQERIKWV
YELFPRLHERRVQRAGTMSGGEQQMLAIGRALMSNPRLLLLDEPSLGLAPIIIQQIFDTI
EQLREQGMTIFLVEQNANQALKLADRGYVLENGHVVLSDTGDALLANEAVRSAYLGG