Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PD444769 score=137 PD772117 score=141


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PD772117
PD444769



HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(105 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

      2-48  #PD444769                                            137 1e-09
     62-92  #PD772117                                            141 3e-10


>PD772117 (Closest domain: Q8CR44_STAES 62-92)
Number of domains in family: 5
Commentary (automatic):
SUBNAME: FULL=PUTATIVE UNCHARACTERIZED  
Length = 31
Score = 141  (58.9 bits), Expect = 3e-10
Identities = 31/31 (100%), Positives = 31/31 (100%)

 Query:     62 SSNNESNNTKAHSFSNSEYKAVNINEAYKNN 92
               SSNNESNNTKAHSFSNSEYKAVNINEAYKNN
 Sbjct:     62 SSNNESNNTKAHSFSNSEYKAVNINEAYKNN 92

>PD444769 (Closest domain: Q8CR44_STAES 2-48) Number of domains in family: 46 Commentary (automatic): SUBNAME: FULL=PUTATIVE UNCHARACTERIZED MEMBRANE REFERENCE SA2321 MW2454 FULL=SIMILAR Length = 47 Score = 137 (57.4 bits), Expect = 1e-09 Identities = 30/47 (63%), Positives = 30/47 (63%)
 Query:      2 EKSVKLAVGXXXXXXXXXXXXXXXXXLIGSLSGKDMSNSVLDTDHSR 48
               EKSVKLAVG                 LIGSLSGKDMSNSVLDTDHSR
 Sbjct:      2 EKSVKLAVGIYLAIILIICSIYLAFILIGSLSGKDMSNSVLDTDHSR 48