Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PDD152J9 score=150 PD462196 score=400


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PD462196
PDD152J9



HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(199 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

      1-48  #PDD152J9                                            150 8e-11
    49-191  #PD462196                                            400 3e-46


>PD462196 (Closest domain: Q8CRD4_STAES 49-191)
Number of domains in family: 49
Commentary (automatic):
SUBNAME: FULL=PUTATIVE UNCHARACTERIZED MEMBRANE PRECURSOR FLAGS: SIGNAL FULL=PROBABLE SERINE/THREONINE-PROTEIN AT5G35370  
Length = 143
Score = 400  (158.7 bits), Expect = 3e-46
Identities = 85/143 (59%), Positives = 88/143 (61%)

 Query:     49 FVNNNIRNHIIWMSPKLDRILGMLSGILYSGIYWVSFIKQQPXXXXXXXXXXXXXXXXXX 108
               FVNNNIRNH+IW+SPKLDRILGM+SGILY GIY V FIKQQP                  
 Sbjct:     49 FVNNNIRNHMIWVSPKLDRILGMISGILYFGIYVVGFIKQQPLWIVILILVSTVGTAVLL 108

 Query:    109 XXKLHITSLQLEERLSSERIKRKVISRHKAQRLKNXXXXXXXXXXXSMLISLYLKLMXXX 168
                 KLHITSLQLEE LSSERIKRKVISRHKAQRLK            SMLISLYLKLM   
 Sbjct:    109 ETKLHITSLQLEETLSSERIKRKVISRHKAQRLKCIFFTVIVVVIISMLISLYLKLMVIF 168

 Query:    169 XXXXXXXXXXXXXXXXFEKYFTI 191
                               FEKYFTI
 Sbjct:    169 GLAVTIFILASISVAIFEKYFTI 191

>PDD152J9 (Closest domain: Q8CRD4_STAES 1-48) Number of domains in family: 2 Commentary (automatic): SUBNAME: FULL=PUTATIVE UNCHARACTERIZED Length = 48 Score = 150 (62.4 bits), Expect = 8e-11 Identities = 31/48 (64%), Positives = 33/48 (68%)
 Query:      1 MKAYLYKFMPXXXXXXXXXXXXXXNDYPTLLHVIVIIVFITSGLKNVY 48
               MKAYLYKFMP              NDYPTL+HVIVII FIT+GLKNVY
 Sbjct:      1 MKAYLYKFMPLLIFVIGLIIFYVFNDYPTLIHVIVIIAFITNGLKNVY 48