Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PD526846 score=177 PD786156 score=211 PDA1V4U2 score=186 PDA2K3G9 score=184 PDC7L8T4 score=163 PD927405 score=137 PDA9T8H7 score=131 PD999834 score=113 PDA1F5E7 score=349


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PDA1F5E7
PD786156
PDA1V4U2
PDA2K3G9
PD526846
PDB5H8I3
PDC7L8T4
PD414066
PDC657H6
PDC66453
PDA857M8
PD927405
PD900101
PDB0F632
PDA9T8H7
PDB0D1K9
PDA026V7
PDA210O4
PDC650L5
PD869428
PDB3L707
PDA857O4
PD999834
PD827414
PDA858L6
PD879289
PD482215
PDB003Y9
PDB3K644
PD925716
PDA1P539

Domain 3D modelling using Swiss-Model

Domain IDBEGINEND 
PD786156
PDA1V4U2
PDA2K3G9
PD526846
PDB5H8I3
PD414066
PDB3K644

Domain 3D modelling using Geno3D

Domain IDBEGINEND 
PD786156
PDA1V4U2
PDA2K3G9
PD526846
PDB5H8I3
PD414066
PDB3K644


HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(401 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

      5-54  #PD526846                                            177 2e-13
      7-46  #PDA858L6                                            111 0.0001
     21-55  #PD869428                                            118 2e-05
     40-99  #PD786156                                            211 3e-18
    62-206  #PDC7L8T4                                            163 1e-10
    65-103  #PDB3K644                                            100 0.004
    67-119  #PD925716                                             99 0.006
    68-101  #PDC650L5                                            118 1e-05
    71-135  #PDA1V4U2                                            186 1e-14
    71-119  #PDA210O4                                            121 8e-06
    71-117  #PDB3L707                                            116 3e-05
    71-160  #PDA2K3G9                                            184 4e-14
    72-114  #PDB5H8I3                                            172 7e-13
    74-134  #PDA1P539                                             99 0.007
    91-166  #PDB003Y9                                            102 0.003
   105-160  #PDC66453                                            145 5e-09
   106-162  #PDA857M8                                            139 3e-08
   117-162  #PDA026V7                                            124 2e-06
   117-156  #PDC657H6                                            147 2e-09
   119-164  #PD414066                                            153 3e-10
   187-258  #PD482215                                            106 0.001
   198-267  #PD927405                                            137 8e-08
   203-262  #PDB0F632                                            132 3e-07
   222-253  #PDB0D1K9                                            124 2e-06
   225-258  #PD879289                                            109 0.0002
   225-274  #PDA857O4                                            115 8e-05
   225-267  #PD900101                                            132 3e-07
   245-307  #PDA9T8H7                                            131 4e-07
   267-306  #PD827414                                            113 9e-05
   310-395  #PD999834                                            113 0.0001
   313-399  #PDA1F5E7                                            349 2e-37


>PDA1F5E7 (Closest domain: Q6L2H9_PICTO 312-399)
Number of domains in family: 442
Commentary (automatic):
SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 AMMONIA-LYASE FULL=L-THREONINE REFERENCE FULL=PUTATIVE THREONINE  
Length = 88
Score = 349  (139.0 bits), Expect = 2e-37
Identities = 65/87 (74%), Positives = 76/87 (87%)

 Query:    313 IIYRALEMENKLLRLEFNLPDHPGIMEKIVNAISSSGANIYHAEVDNLNKDTPIGYQYLL 372
               IIY+++EMENKL+RLEFNLPD PG M KIVNAISS GANIYHAEVDNL K+TPIGYQ L 
 Sbjct:    313 IIYKSMEMENKLIRLEFNLPDRPGTMVKIVNAISSVGANIYHAEVDNLKKNTPIGYQNLT 372

 Query:    373 FTINILDKSRIDELLGSLDKLGYKYRI 399
               FT+NI+D +RI++LL +LD LGYKY I
 Sbjct:    373 FTVNIVDANRIEKLLNALDSLGYKYNI 399

>PD786156 (Closest domain: G7WCI1_DESOD 41-101) Number of domains in family: 1947 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC DEHYDRATASE AMMONIA-LYASE THREONINE FULL=L-THREONINE Length = 61 Score = 211 (85.9 bits), Expect = 3e-18 Identities = 41/60 (68%), Positives = 47/60 (78%)
 Query:     40 KMENFQKTGSFKSRGAMVKFSTLTAEQKKNGVITASAGNHAQGVAFAASYYGVDAKIVMP 99
               KMEN Q+TGSFK RGA  K S LT E+K+ GVI +SAGNHAQGVA AA+ YG+ A IVMP
 Sbjct:     42 KMENLQRTGSFKLRGAYNKISNLTPEEKQRGVIASSAGNHAQGVAVAATLYGIKATIVMP 101

>PDA1V4U2 (Closest domain: A8MDC1_CALMQ 86-152) Number of domains in family: 465 Commentary (automatic): SUBNAME: LYASE AMMONIA-LYASE FULL=DIAMINOPROPIONATE EC=4.3.1.15 FULL=PUTATIVE FULL=THREONINE SYNTHASE DEHYDRATASE EC=4.3.1.19 Length = 67 Score = 186 (76.3 bits), Expect = 1e-14 Identities = 35/65 (53%), Positives = 49/65 (75%)
 Query:     71 VITASAGNHAQGVAFAASYYGVDAKIVMPETTPPAKVNAVQSYGGTVILKGNSYDEAHEY 130
               V+TASAGNHAQGVA+ A  YG+ + IVMP+ TP  K++  + YG  VIL+G SY EA +Y
 Sbjct:     86 VVTASAGNHAQGVAYVAKIYGLKSTIVMPKYTPWIKISNTRKYGAEVILEGQSYYEAEKY 145

 Query:    131 AVQVS 135
               A++++
 Sbjct:    146 AIELT 150

>PDA2K3G9 (Closest domain: E3MDM3_CAERE 304-393) Number of domains in family: 166 Commentary (automatic): SUBNAME: LYASE AMMONIA-LYASE FULL=DIAMINOPROPIONATE FULL=PUTATIVE EC=4.3.1.15 DEHYDRATASE UNCHARACTERIZED ALTNAME: EC=4.3.1.19 Length = 90 Score = 184 (75.5 bits), Expect = 4e-14 Identities = 35/90 (38%), Positives = 53/90 (58%)
 Query:     71 VITASAGNHAQGVAFAASYYGVDAKIVMPETTPPAKVNAVQSYGGTVILKGNSYDEAHEY 130
               V  ASAGNHA  ++      GV+  +VMP   P  K+N  Q  G  +++KGN   E+ E 
 Sbjct:    304 VYAASAGNHALALSLHGKQLGVEVNVVMPIIAPLMKINRCQELGANILVKGNDIAESREI 363

 Query:    131 AVQVSVDEKREFIEAYNDEDVIAGQGTIGL 160
               A+Q++ D +  +I  Y+  D++AG GT+GL
 Sbjct:    364 ALQLAYDNQGTYINGYDHYDILAGAGTVGL 393

>PD526846 (Closest domain: Q6L2H9_PICTO 4-53) Number of domains in family: 939 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 AMMONIA-LYASE FULL=L-THREONINE CATABOLIC THREONINE BETA Length = 50 Score = 177 (72.8 bits), Expect = 2e-13 Identities = 32/50 (64%), Positives = 40/50 (80%)
 Query:      5 DRIVRAGNEIKGKIHRTPLFHSTTFSNMFSCDVYFKMENFQKTGSFKSRG 54
               D I+ A + +   +HRTP+FHS TFS+MF  D++FKMENFQKTGSFKSRG
 Sbjct:      4 DDILYAKSVVSRYLHRTPVFHSKTFSDMFHGDIFFKMENFQKTGSFKSRG 53

>PDB5H8I3 (Closest domain: Q6L2H9_PICTO 71-113) Number of domains in family: 262 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 FULL=PUTATIVE BETA FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT SUBUNIT AMMONIA-LYASE Length = 43 Score = 172 (70.9 bits), Expect = 7e-13 Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 5/43 (11%)
 Query:     72 ITASAGNHAQGVAFAASYYGVDAKIVMPETTPPAKVNAVQSYG 114
               ITASAGNHAQGVA+AAS +  DAKIVMPE T PAKVNAV++YG
 Sbjct:     71 ITASAGNHAQGVAYAASIFKTDAKIVMPENTTPAKVNAVEAYG 113

>PDC7L8T4 (Closest domain: F4X1E5_ACREC 163-319) Number of domains in family: 8 Commentary (automatic): SUBNAME: SYNTHETASE AMINOACYL-TRNA FULL=PUTATIVE UNCHARACTERIZED NUCLEOTIDE-BINDING FULL=BIFUNCTIONAL ATP-BINDING LIGASE BIOSYNTHESIS Length = 157 Score = 163 (67.4 bits), Expect = 1e-10 Identities = 43/147 (29%), Positives = 73/147 (49%), Gaps = 2/147 (1%)
 Query:     62 LTAEQKKNGVITASAGNHAQGVAFAASYYGVDAKIVMPETTPPAKVNAVQSY-GGTVILK 120
               L+ EQK  GV+T S+G+ A  +   A +  +   +VMP TT   K+   Q Y    V+++
 Sbjct:    168 LSEEQKCKGVVTISSGSFAFTICHYAHHNEIPVTVVMPSTTAKEKIEMCQGYLLARVLVR 227

 Query:    121 GNSYDEAHEYAVQVSVDEKREFIEAYNDEDVIAGQGTIGLEIL-EDVKPDXXXXXXXXXX 179
               GN+  EAH  A+ +++ E   +++  +  ++I GQ T+G+EI+ +  K D          
 Sbjct:    228 GNNLLEAHRAALDIAMREDLFYLDGNDHPNMIIGQATLGIEIMQQQSKIDVVLLPTTIKN 287

 Query:    180 XXXXXXFAIKSKNKDIKIIGVESEKAN 206
                      AI  K  + KI  +E +  N
 Sbjct:    288 CGLTTAIAIAIKGYNSKITVIEVQGTN 314

>PD414066 (Closest domain: Q97CB2_THEVO 124-169) Number of domains in family: 1521 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC AMMONIA-LYASE FULL=L-THREONINE DEHYDRATASE DEAMINASE Length = 46 Score = 153 (63.5 bits), Expect = 3e-10 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 3/46 (6%)
 Query:    119 LKGNSYDEAHEYAVQVSVDEKREFIEAYNDEDVIAGQGTIGLEILE 164
               LKG+ YDEAH YA +++  E R FIEA+ND  VI+GQGTIGLEI+E
 Sbjct:    124 LKGSDYDEAHRYADEIAKQEGRIFIEAFNDRWVISGQGTIGLEIME 169

>PDC657H6 (Closest domain: Q6L2H9_PICTO 116-155) Number of domains in family: 135 Commentary (automatic): SUBNAME: FULL=THREONINE LYASE EC=4.3.1.19 DEHYDRATASE AMMONIA-LYASE FULL=L-THREONINE BIOSYNTHETIC EC=4.3.1.17 DEHYDRATASE Length = 40 Score = 147 (61.2 bits), Expect = 2e-09 Identities = 26/40 (65%), Positives = 34/40 (85%), Gaps = 3/40 (7%)
 Query:    117 VILKGNSYDEAHEYAVQVSVDEKREFIEAYNDEDVIAGQG 156
               VIL G SYDE+H +A+++++DE R FIEAYNDE +IAGQG
 Sbjct:    116 VILTGRSYDESHSHALKIAMDENRTFIEAYNDEAIIAGQG 155

>PDC66453 (Closest domain: G0LHX5_HALWC 105-160) Number of domains in family: 110 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT FULL=PUTATIVE AMMONIA-LYASE Length = 56 Score = 145 (60.5 bits), Expect = 5e-09 Identities = 25/56 (44%), Positives = 41/56 (73%), Gaps = 3/56 (5%)
 Query:    105 AKVNAVQSYGGTVILKGNSYDEAHEYAVQVSVDEKREFIEAYNDEDVIAGQGTIGL 160
               +K+ A + YGG  +L+G  YDEA  YA Q++ + ++ ++ A++D+ V+AGQGTIGL
 Sbjct:    105 SKIEATERYGGDTVLQGTDYDEAQAYAHQLAEESRQTYVHAFDDKAVMAGQGTIGL 160

>PDA857M8 (Closest domain: A5WDI9_PSYWF 106-163) Number of domains in family: 57 Commentary (automatic): SUBNAME: BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT LYASE FULL=THREONINE FULL=PUTATIVE EC=4.3.1.19 DEHYDRATASE UNCHARACTERIZED Length = 58 Score = 139 (58.2 bits), Expect = 3e-08 Identities = 28/57 (49%), Positives = 42/57 (73%), Gaps = 3/57 (5%)
 Query:    106 KVNAVQSYGGTVILKGNSYDEAHEYAVQVSVDEKREFIEAYNDEDVIAGQGTIGLEI 162
               KV AV++ GG V L G+S+D +++YA++ S+ E   +I  Y+DE VIAGQGT+ LE+
 Sbjct:    106 KVQAVKALGGKVDLYGDSFDVSNQYAIERSIKEGLTYIPPYDDELVIAGQGTVALEL 162

>PD927405 (Closest domain: Q31AZ3_PROM9 201-270) Number of domains in family: 543 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC AMMONIA-LYASE DEHYDRATASE FULL=L-THREONINE THREONINE Length = 70 Score = 137 (57.4 bits), Expect = 8e-08 Identities = 30/70 (42%), Positives = 45/70 (64%), Gaps = 2/70 (2%)
 Query:    198 IGVESEKANAMELSIKEGKIVPYTSNDTIADGIAVKYPGNITFELVKKYVDGVVTVSDEN 257
               IGVE + A+AM  S++E KIV   S    ADG+AVK  GN TF++ +KY+D ++ V+ + 
 Sbjct:    201 IGVEPQDADAMSKSLEESKIVELASVGQFADGVAVKKVGNNTFDIGRKYIDKMIRVNTDE 260

 Query:    258 IAYALFKLLE 267
               I  A+  + E
 Sbjct:    261 ICAAIKDVFE 270

>PD900101 (Closest domain: Q095H4_STIAD 221-270) Number of domains in family: 68 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE FULL=PUTATIVE REFERENCE UNCHARACTERIZED EC=4.3.1.19 LYASE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA Length = 50 Score = 132 (55.5 bits), Expect = 3e-07 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Query:    225 TIADGIAVKYPGNITFELVKKYVDGVVTVSDENIAYALFKLLE 267
               TIA+GI+V+ PG++TF +V+KYVD +VTV +E IA A+  LLE
 Sbjct:    228 TIAEGISVRKPGDLTFPMVRKYVDEIVTVDEEEIANAILVLLE 270

>PDB0F632 (Closest domain: F7UW02_EEGSY 269-329) Number of domains in family: 53 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA SUBUNIT LYASE EC=4.3.1.19 THREONINE FULL=PUTATIVE Length = 61 Score = 132 (55.5 bits), Expect = 3e-07 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 1/60 (1%)
 Query:    203 EKANAMELSIKEGKIVPYTSNDTIADGIAVKYPGNITFELVKKYVDGVVTVSDENIAYAL 262
               E   +M +S+  GK     + D++ADGI V  PG  TFE+V+ YVDGV TV+++ IA A+
 Sbjct:    269 EAVPSMHVSLAAGKRTGVEAKDSLADGIHVAMPGEKTFEVVQTYVDGVYTVTEQQIAEAI 328

>PDA9T8H7 (Closest domain: A0Q0J5_CLONN 247-309) Number of domains in family: 658 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC DEHYDRATASE AMMONIA-LYASE FULL=L-THREONINE DEAMINASE Length = 63 Score = 131 (55.1 bits), Expect = 4e-07 Identities = 27/63 (42%), Positives = 41/63 (65%), Gaps = 1/63 (1%)
 Query:    245 KYVDGVVTVSDENIAYALFKLLEREKVLVEPSGAAGLAALFENXXXXXXXXXXXXLSGGN 304
               KYVD VVT++++ IA+A+F+L++R K+L E +GA+ LAAL               +SGGN
 Sbjct:    247 KYVDEVVTITEDEIAHAMFQLMQRGKLLAEGAGASPLAALLAGKIKVDGKKVALLVSGGN 306

 Query:    305 VNF 307
               V+ 
 Sbjct:    307 VDM 309

>PDB0D1K9 (Closest domain: E3IBV7_GEOS0 217-254) Number of domains in family: 538 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC AMMONIA-LYASE DEAMINASE FULL=L-THREONINE DEHYDRATASE Length = 38 Score = 124 (52.4 bits), Expect = 2e-06 Identities = 24/32 (75%), Positives = 29/32 (90%), Gaps = 1/32 (3%)
 Query:    222 SNDTIADGIAVKYPGNITFELVKKYVDGVVTV 253
               S+DTIADGIAVK PGNIT++ ++KYVDGVV V
 Sbjct:    223 SSDTIADGIAVKKPGNITYQYIEKYVDGVVCV 254

>PDA026V7 (Closest domain: Q095H4_STIAD 118-164) Number of domains in family: 680 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA SUBUNIT FULL=PUTATIVE AMMONIA-LYASE Length = 47 Score = 124 (52.4 bits), Expect = 2e-06 Identities = 25/46 (54%), Positives = 34/46 (73%), Gaps = 1/46 (2%)
 Query:    117 VILKGNSYDEAHEYAVQVSVDEKREFIEAYNDEDVIAGQGTIGLEI 162
               VILKG+++DEA+  A++V   E   F+  +ND  VIAGQGTIGLE+
 Sbjct:    119 VILKGSNFDEAYAEALRVQEQENLVFVHPFNDPHVIAGQGTIGLEL 164

>PDA210O4 (Closest domain: E9F7X7_METAR 75-124) Number of domains in family: 232 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=PUTATIVE FULL=L-SERINE LYASE UNCHARACTERIZED EC=4.3.1.19 EC=4.3.1.17 BETA FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT Length = 50 Score = 121 (51.2 bits), Expect = 8e-06 Identities = 24/49 (48%), Positives = 31/49 (63%), Gaps = 1/49 (2%)
 Query:     71 VITASAGNHAQGVAFAASYYGVDAKIVMPETTPPAKVNAVQSYGGTVIL 119
               +ITAS+GNH  G A AA     D  +V+P+   PAK+  +QSYG  VIL
 Sbjct:     75 LITASSGNHGIGAACAARALSKDLTVVLPDAVVPAKLRKIQSYGARVIL 123

>PDC650L5 (Closest domain: G0IG36_BACAM 77-110) Number of domains in family: 178 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC FULL=L-THREONINE BIOSYNTHESIS AMMONIA-LYASE ILVA Length = 34 Score = 118 (50.1 bits), Expect = 1e-05 Identities = 20/34 (58%), Positives = 26/34 (76%), Gaps = 1/34 (2%)
 Query:     68 KNGVITASAGNHAQGVAFAASYYGVDAKIVMPET 101
               +NG++ ASAGNHAQGVAF+  + G+  KI MP T
 Sbjct:     77 ENGIVCASAGNHAQGVAFSCKHLGIHGKIFMPST 110

>PD869428 (Closest domain: F4Q8I7_DICFS 771-816) Number of domains in family: 289 Commentary (automatic): SUBNAME: SYNTHASE FULL=THREONINE LYASE FULL=L-SERINE DEHYDRATASE FULL=PUTATIVE EC=4.2.3.1 EC=4.3.1.17 UNCHARACTERIZED Length = 46 Score = 118 (50.1 bits), Expect = 2e-05 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 1/35 (2%)
 Query:     21 TPLFHSTTFSNMFSCDVYFKMENFQKTGSFKSRGA 55
               TP++HSTT+S +  C V   +EN QKTGSFK RG+
 Sbjct:    772 TPIYHSTTYSKLCGCKVTLMLENIQKTGSFKIRGS 806

>PDB3L707 (Closest domain: D8HM05_AMYMU 73-119) Number of domains in family: 12 Commentary (automatic): SUBNAME: SCAFFOLD BIOSYNTHESIS FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT REFERENCE FULL=PUTATIVE UNCHARACTERIZED BETA SUBUNIT CYSTEINE Length = 47 Score = 116 (49.3 bits), Expect = 3e-05 Identities = 23/47 (48%), Positives = 29/47 (61%), Gaps = 2/47 (4%)
 Query:     71 VITASAGNHAQGVAFAASYYGVDAKIVMPETTPPAKVNAVQSYGGTV 117
               V+ ASAGNHAQGVA A+S  G  + + MP   P  K+ A + YG  V
 Sbjct:     73 VVAASAGNHAQGVALASSLLGAKSTVFMPLRAPLPKLAATRGYGADV 119

>PDA857O4 (Closest domain: Q7VZT8_BORPE 224-309) Number of domains in family: 91 Commentary (automatic): SUBNAME: LYASE DEHYDRATASE BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT FULL=PUTATIVE FULL=THREONINE EC=4.3.1.19 THREONINE Length = 86 Score = 115 (48.9 bits), Expect = 8e-05 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 9/50 (18%)
 Query:    225 TIADGIAVKYPGNITFELVKKYVDGVVTVSDENIAYALFKLLEREKVLVE 274
               TIA+GIAVK PG +T E+V + VD +  V++ +I +A+  LLE EK +VE
 Sbjct:    224 TIAEGIAVKSPGTLTQEIVTRLVDHIELVNESDIEHAIVVLLEIEKTVVE 273

>PD999834 (Closest domain: A7G8W1_CLOBH 312-404) Number of domains in family: 11 Commentary (automatic): FULL=THREONINE SUBNAME: EC=4.3.1.19 LYASE AMMONIA-LYASE DEHYDRATASE REFERENCE CATABOLIC Length = 93 Score = 113 (48.1 bits), Expect = 0.0001 Identities = 28/86 (32%), Positives = 45/86 (52%), Gaps = 1/86 (1%)
 Query:    310 LSNIIYRALEMENKLLRLEFNLPDHPGIMEKIVNAISSSGANIYHAEVDNLNKDTPIGYQ 369
               +S II R L M  + +R +  L D  G  E +++ I S+GANI  A  D    +  + Y 
 Sbjct:    312 ISKIIDRQLIMLKRRIRFKVELQDKIGEFEDVISNIVSTGANIVKARQDTNWSEKGLEYA 371

 Query:    370 YLLFTINILDKSRIDELLGSLDKLGY 395
                ++F + +  K + D+LL  L + GY
 Sbjct:    372 NVIFEVEVQSKEQGDKLLKQLSEKGY 397

>PD827414 (Closest domain: Q6L2H9_PICTO 267-306) Number of domains in family: 1184 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 AMMONIA-LYASE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA SUBUNIT FULL=L-THREONINE Length = 40 Score = 113 (48.1 bits), Expect = 9e-05 Identities = 24/40 (60%), Positives = 26/40 (65%), Gaps = 1/40 (2%)
 Query:    267 EREKVLVEPSGAAGLAALFENXXXXXXXXXXXXLSGGNVN 306
               EREKVLVEPSGA GLAAL+E             LSGGN+N
 Sbjct:    267 EREKVLVEPSGAVGLAALYEGKIDSESKKTAIILSGGNIN 306

>PDA858L6 (Closest domain: Q4JAT7_SULAC 10-49) Number of domains in family: 337 Commentary (automatic): SUBNAME: DEHYDRATASE LYASE FULL=THREONINE EC=4.3.1.19 FULL=PUTATIVE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA SUBUNIT UNCHARACTERIZED Length = 40 Score = 111 (47.4 bits), Expect = 0.0001 Identities = 22/40 (55%), Positives = 27/40 (67%), Gaps = 1/40 (2%)
 Query:      7 IVRAGNEIKGKIHRTPLFHSTTFSNMFSCDVYFKMENFQK 46
               IV+    IK  IH+TPL +S+TFSN+    VY KMEN QK
 Sbjct:     10 IVKVHESIKQYIHKTPLDYSSTFSNIAGAKVYLKMENLQK 49

>PD879289 (Closest domain: F8I4E7_SULAT 229-263) Number of domains in family: 505 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT FULL=PUTATIVE AMMONIA-LYASE Length = 35 Score = 109 (46.6 bits), Expect = 0.0002 Identities = 20/34 (58%), Positives = 28/34 (82%), Gaps = 1/34 (2%)
 Query:    225 TIADGIAVKYPGNITFELVKKYVDGVVTVSDENI 258
               TIADGIAVK+PG +TF +++ YVD +VTV + +I
 Sbjct:    230 TIADGIAVKHPGALTFRMIEHYVDELVTVDEHDI 263

>PD482215 (Closest domain: C6BF04_RALP1 185-270) Number of domains in family: 104 Commentary (automatic): SUBNAME: LYASE AMMONIA-LYASE FULL=DIAMINOPROPIONATE FULL=PUTATIVE EC=4.3.1.15 FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT UNCHARACTERIZED BETA SUBUNIT Length = 86 Score = 106 (45.4 bits), Expect = 0.001 Identities = 23/75 (30%), Positives = 42/75 (56%), Gaps = 3/75 (4%)
 Query:    187 AIKSKNK---DIKIIGVESEKANAMELSIKEGKIVPYTSNDTIADGIAVKYPGNITFELV 243
               A++++N      +I+GV S  A   E S+K G +V    +  +ADG+A + P     E++
 Sbjct:    196 AVRARNALALSTRIVGVVSAHARCYEQSLKSGTVVSAPVSTLLADGLACRTPDANALEVI 255

 Query:    244 KKYVDGVVTVSDENI 258
               +  VD V+ V+D+ +
 Sbjct:    256 RAGVDEVIAVTDDEV 270

>PDB003Y9 (Closest domain: D0L7I5_GORB4 135-230) Number of domains in family: 141 Commentary (automatic): SUBNAME: SYNTHASE FULL=THREONINE LYASE EC=4.2.3.1 BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT THREONINE FULL=PUTATIVE Length = 96 Score = 102 (43.9 bits), Expect = 0.003 Identities = 29/79 (36%), Positives = 45/79 (56%), Gaps = 8/79 (10%)
 Query:     91 GVDAKIVMPETTPPAKVNAVQSYGGTVILKGNSYDEAHEYAVQVSVDEKREFI--EAYND 148
               G+DAKI++P  T PAK+   ++YG  + L G + D+  + A++ S      FI   ++N 
 Sbjct:    137 GMDAKILVPAATSPAKILQARAYGAEIELVGGTRDDVGDEAIRQSA-----FIPYASHNW 191

 Query:    149 EDV-IAGQGTIGLEILEDV 166
                 + I G  TIG EI ED+
 Sbjct:    192 HPMFIQGTKTIGYEIWEDL 210

>PDB3K644 (Closest domain: SRR_HUMAN 68-111) Number of domains in family: 7 Commentary (automatic): SUBNAME: ALTNAME: FULL=SERINE RACEMASE FULL=D-SERINE DEACETYLASE FULL=L-SERINE AMMONIA-LYASE FULL=ACETYLORNITHINE EC=4.3.1.17 Length = 44 Score = 100 (43.1 bits), Expect = 0.004 Identities = 18/39 (46%), Positives = 26/39 (66%), Gaps = 1/39 (2%)
 Query:     65 EQKKNGVITASAGNHAQGVAFAASYYGVDAKIVMPETTP 103
               E+K   V+T S+GNH Q + +AA   G+ A IV+P+T P
 Sbjct:     73 ERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAP 111

>PD925716 (Closest domain: G2PL89_MURRD 50-115) Number of domains in family: 3520 Commentary (automatic): BIOSYNTHESIS SYNTHASE FULL=CYSTEINE EC=2.5.1.47 TRANSFERASE RECNAME: CYSTEINE AMINO-ACID SUBNAME: LYASE Length = 66 Score = 99 (42.7 bits), Expect = 0.006 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Query:     67 KKNGVITASAGNHAQGVAFAASYYGVDAKIVMPETTPPAKVNAVQSYGGTVIL 119
               K   +I A++GN   G+A  A  +G+D ++VMPE +   +V  +++YG  V L
 Sbjct:     61 KSTKLIEATSGNTGIGLAMIAGLFGLDIELVMPENSTKERVQTMRAYGAKVTL 113

>PDA1P539 (Closest domain: D2S0A7_HALTV 134-196) Number of domains in family: 754 Commentary (automatic): SUBNAME: SYNTHASE FULL=THREONINE LYASE EC=4.2.3.1 FULL=L-THREONINE REFERENCE THREONINE FULL=PUTATIVE THRC Length = 63 Score = 99 (42.7 bits), Expect = 0.007 Identities = 22/61 (36%), Positives = 34/61 (55%), Gaps = 1/61 (1%)
 Query:     74 ASAGNHAQGVAFAASYYGVDAKIVMPETTPPAKVNAVQSYGGTVILKGNSYDEAHEYAVQ 133
               AS GN A  ++  A+  G+D +I +P   P  K+     YG  V+    SYDEA++ +V+
 Sbjct:    136 ASTGNAAASLSGYAARGGLDCRIFVPGAAPAGKLAQPLVYGADVLAVNGSYDEAYDLSVE 195

 Query:    134 V 134
               V
 Sbjct:    196 V 196