Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PDA0U080 score=191 PDB020B7 score=126 PD351786 score=245 PD690281 score=311 PDA9Z6V1 score=473 PDA1L523 score=319 PD186234 score=329 PDA1L523 score=319 PDB00405 score=196 PD471754 score=261


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PDA9Z6V1
PD186234
PDA1L523
PD690281
PD471754
PD351786
PDB00405
PDA0U080
PD331496
PDA239A2
PD041942
PDB020B7
PDA5C2J6
PDA1S6D5
PDA9Z7A1
PDC56346
PD892055
PD715843

Domain 3D modelling using Swiss-Model

Domain IDBEGINEND 
PDA9Z6V1
PD186234
PDA1L523
PD690281
PD471754

Domain 3D modelling using Geno3D

Domain IDBEGINEND 
PDA9Z6V1
PD186234
PDA1L523
PD690281
PD471754


HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(388 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

    10-110  #PDB020B7                                            126 3e-06
     10-45  #PDA0U080                                            191 1e-15
    58-105  #PD351786                                            245 3e-23
    72-280  #PD690281                                            311 2e-30
    76-110  #PD715843                                             99 0.006
    98-222  #PD331496                                            175 1e-12
   103-160  #PD892055                                            101 0.003
   123-259  #PD041942                                            129 2e-06
   123-210  #PDA9Z6V1                                            473 1e-55
   163-221  #PDC56346                                            106 0.0008
   203-305  #PDA1L523                                            319 6e-33
   205-248  #PDA239A2                                            129 8e-07
   230-279  #PDA1S6D5                                            112 0.0001
   233-295  #PD186234                                            329 9e-35
   297-369  #PDB00405                                            196 6e-16
   318-371  #PD471754                                            261 3e-25
   325-371  #PDA5C2J6                                            113 0.0001
   329-369  #PDA9Z7A1                                            111 0.0002


>PDA9Z6V1 (Closest domain: Q6GFZ1_STAAR 112-201)
Number of domains in family: 3281
Commentary (automatic):
SUBNAME: PYRIDOXAL PHOSPHATE TRANSFERASE FULL=CYSTEINE DESULFURASE EC=2.8.1.7 AMINOTRANSFERASE RECNAME: CLASS  
Length = 90
Score = 473  (186.8 bits), Expect = 1e-55
Identities = 88/88 (100%), Positives = 88/88 (100%)

 Query:    123 GFKVKYVDVTKDGTIDLQHFNDLMSDKVGLVTCMYVNNVTGQIQPIPQMAEVIKNYPKAH 182
               GFKVKYVDVTKDGTIDLQHFNDLMSDKVGLVTCMYVNNVTGQIQPIPQMAEVIKNYPKAH
 Sbjct:    114 GFKVKYVDVTKDGTIDLQHFNDLMSDKVGLVTCMYVNNVTGQIQPIPQMAEVIKNYPKAH 173

 Query:    183 FHVDAVQAFGKISMDFNNVDSISLSGHK 210
               FHVDAVQAFGKISMDFNNVDSISLSGHK
 Sbjct:    174 FHVDAVQAFGKISMDFNNVDSISLSGHK 201

>PD186234 (Closest domain: C8A4W7_STAAU 233-295) Number of domains in family: 2944 Commentary (automatic): PYRIDOXAL PHOSPHATE SUBNAME: TRANSFERASE DESULFURASE FULL=CYSTEINE EC=2.8.1.7 AMINOTRANSFERASE RECNAME: CLASS Length = 63 Score = 329 (131.3 bits), Expect = 9e-35 Identities = 63/63 (100%), Positives = 63/63 (100%)
 Query:    233 QGGGQEYGVRSGTVNLPNDIAMVKAMKMANENLEALNAFVTELNNDVRQFLSQYQGVYIN 292
               QGGGQEYGVRSGTVNLPNDIAMVKAMKMANENLEALNAFVTELNNDVRQFLSQYQGVYIN
 Sbjct:    233 QGGGQEYGVRSGTVNLPNDIAMVKAMKMANENLEALNAFVTELNNDVRQFLSQYQGVYIN 292

 Query:    293 SST 295
               SST
 Sbjct:    293 SST 295

>PDA1L523 (Closest domain: C5QT92_STAEP 194-296) Number of domains in family: 397 Commentary (automatic): SUBNAME: PHOSPHATE PYRIDOXAL TRANSFERASE AMINOTRANSFERASE FULL=CYSTEINE DESULFURASE CLASS EC=2.8.1.7 V Length = 103 Score = 319 (127.5 bits), Expect = 6e-33 Identities = 61/103 (59%), Positives = 78/103 (75%)
 Query:    203 SISLSGHKFNGLKGQGVLLVNHIQNIEPIIQGGGQEYGVRSGTVNLPNDIAMVKAMKMAN 262
               S+SLSGHKFNGLKGQG+LL+ +IQNIEP+I GGGQEYG+RSGTVNLP  I+MVKA+K A 
 Sbjct:    194 SLSLSGHKFNGLKGQGLLLIKNIQNIEPVIHGGGQEYGLRSGTVNLPMAISMVKAIKQAV 253

 Query:    263 ENLEALNAFVTELNNDVRQFLSQYQGVYINSSTSGSPFVLNIS 305
               +  E  N  +   N  +  FL  ++GVYINS  +G+P ++NI 
 Sbjct:    254 QGTEETNRKLKLFNQAIVTFLKDFKGVYINSPENGAPHIINIG 296

>PD690281 (Closest domain: F2LIV9_BURGS 60-282) Number of domains in family: 4402 Commentary (automatic): FULL=GLYCINE ALTNAME: RECNAME: DEHYDROGENASE SUBUNIT PYRIDOXAL EC=1.4.4.2 CLEAVAGE DECARBOXYLASE DECARBOXYLATING Length = 223 Score = 311 (124.4 bits), Expect = 2e-30 Identities = 78/213 (36%), Positives = 114/213 (53%), Gaps = 7/213 (3%)
 Query:     72 DVVFTSGATESNNIALKGVAYRKFDTAREIITSVLEHPSXXXXXXXXXXXXGFKVKYVDV 131
               ++V+TSGATESNN+ALKG A +  +  R +ITS +EH +            GF V Y+  
 Sbjct:     71 EIVWTSGATESNNLALKGYADKAGER-RHLITSRIEHKA-ILDTMASLAKHGFVVSYLAP 128

 Query:    132 TKDGTIDLQHFNDLMSDKVGLVTCMYVNNVTGQIQPIPQMAEVIKNYPKAHFHVDAVQAF 191
                 +G I  +   + ++   GLV+ M VNN  G +  I  +A V+ +   A  HVDA QA 
 Sbjct:    129 APNGEISAEAVTEAIAPDTGLVSLMLVNNEIGTLSDIAAIARVV-HAAGALLHVDAAQAL 187

 Query:    192 GKISMDFN--NVDSISLSGHKFNGLKGQGVLLVNH--IQNIEPIIQGGGQEYGVRSGTVN 247
               GK ++D     +D +S+S HK  G KG G L V     + I P + GGG E G+RSGT+ 
 Sbjct:    188 GKTAIDVRALGIDMLSMSAHKVYGPKGIGALYVRREIAERIAPQMHGGGHERGLRSGTLA 247

 Query:    248 LPNDIAMVKAMKMANENLEALNAFVTELNNDVR 280
                   + M  A ++A   LE+  A +  L+  +R
 Sbjct:    248 THQIVGMGTACEVAAAALESDTARIATLSEGLR 280

>PD471754 (Closest domain: G0LUV6_STAAU 318-378) Number of domains in family: 1336 Commentary (automatic): SUBNAME: PHOSPHATE PYRIDOXAL TRANSFERASE DESULFURASE FULL=CYSTEINE AMINOTRANSFERASE EC=2.8.1.7 V CLASS Length = 61 Score = 261 (105.1 bits), Expect = 3e-25 Identities = 54/54 (100%), Positives = 54/54 (100%), Gaps = 4/54 (7%)
 Query:    318 FSKYDIMISTTSACSSKRNKLNEVLAAMGLSDKSIEGSIRLSFGATTTKEDIAR 371
               FSKYDIMISTTSACSSKRNKLNEVLAAMGLSDKSIEGSIRLSFGATTTKEDIAR
 Sbjct:    318 FSKYDIMISTTSACSSKRNKLNEVLAAMGLSDKSIEGSIRLSFGATTTKEDIAR 371

>PD351786 (Closest domain: G0LUV6_STAAU 53-105) Number of domains in family: 2992 Commentary (automatic): PYRIDOXAL PHOSPHATE SUBNAME: TRANSFERASE FULL=CYSTEINE DESULFURASE EC=2.8.1.7 RECNAME: AMINOTRANSFERASE CLASS Length = 53 Score = 245 (99.0 bits), Expect = 3e-23 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 4/48 (8%)
 Query:     58 KVQINDMVNTNMTYDVVFTSGATESNNIALKGVAYRKFDTAREIITSV 105
               KVQINDMVNTNMTYDVVFTSGATESNNIALKGVAYRKFDTAREIITSV
 Sbjct:     58 KVQINDMVNTNMTYDVVFTSGATESNNIALKGVAYRKFDTAREIITSV 105

>PDB00405 (Closest domain: F4A042_MAHA5 290-379) Number of domains in family: 734 Commentary (automatic): SUBNAME: PYRIDOXAL PHOSPHATE TRANSFERASE DESULFURASE FULL=CYSTEINE AMINOTRANSFERASE EC=2.8.1.7 CLASS V Length = 90 Score = 196 (80.1 bits), Expect = 6e-16 Identities = 38/73 (52%), Positives = 51/73 (69%), Gaps = 2/73 (2%)
 Query:    297 GSPFVLNISFPGVKGEVLVNAFSKYDIMISTTSACSSKRNKLNEVLAAMGLSDKSIEGSI 356
               G+P +LNISF GV+GEVLV+A  +  I +ST SACSS++ K++ VL AMGL   S E +I
 Sbjct:    292 GAPHILNISFNGVRGEVLVHALEQEGIYVSTGSACSSRKQKVSHVLKAMGLPTASCESAI 351

 Query:    357 RLSFGATTTKEDI 369
               R S     T++DI
 Sbjct:    352 RFSLSTLNTQDDI 364

>PDA0U080 (Closest domain: Q7A548_STAAN 1-41) Number of domains in family: 3650 Commentary (automatic): SUBNAME: PYRIDOXAL PHOSPHATE TRANSFERASE DESULFURASE FULL=CYSTEINE EC=2.8.1.7 AMINOTRANSFERASE RECNAME: CLASS Length = 41 Score = 191 (78.2 bits), Expect = 1e-15 Identities = 35/36 (97%), Positives = 36/36 (100%), Gaps = 10/36 (27%)
 Query:     10 LIYLDNAATTKAFEEVLDTYLKVNQSMYYNPNSPHK 45
               +IYLDNAATTKAFEEVLDTYLKVNQSMYYNPNSPHK
 Sbjct:      1 MIYLDNAATTKAFEEVLDTYLKVNQSMYYNPNSPHK 36

>PD331496 (Closest domain: G2LNP2_BUCUM 90-221) Number of domains in family: 1097 Commentary (automatic): SUBNAME: DECARBOXYLASE LYASE PHOSPHATE PYRIDOXAL FULL=ORN/LYS/ARG FULL=PUTATIVE FULL=PYRIDOXAL-DEPENDENT MAJOR SYNTHASE Length = 132 Score = 175 (72.0 bits), Expect = 1e-12 Identities = 48/127 (37%), Positives = 66/127 (51%), Gaps = 4/127 (3%)
 Query:     98 AREIITSVLEHPSXXXXXXXXXXXXGFKVKYVDVTKDGTIDLQHFNDLMSDKVGLVTCMY 157
                + IITS  EH S            GF V Y+    +G IDL    + +     L++ M+
 Sbjct:     94 GKHIITSKTEHKSVLDSCRYLESK-GFHVTYLTPKNNGIIDLNDLKNSIQKDTILISIMH 152

 Query:    158 VNNVTGQIQPIPQMAEVIKNYPKAHFHVDAVQAFGKISMDFN--NVDSISLSGHKFNGLK 215
               VNN  G IQ I  ++++ KNY    FHVDA Q+ GKI ++ N  ++D +S S HK  G K
 Sbjct:    153 VNNEIGIIQDINSISKICKNY-NIFFHVDATQSIGKIPINLNAIDIDLMSFSAHKVYGPK 211

 Query:    216 GQGVLLV 222
               G G L V
 Sbjct:    212 GIGGLYV 218

>PDA239A2 (Closest domain: F0T3T3_CHLP6 187-252) Number of domains in family: 55 Commentary (automatic): SUBNAME: PYRIDOXAL PHOSPHATE DESULFURASE FULL=CYSTEINE CYSTEINE FULL=PUTATIVE TRANSFERASE DESULFARASE AMINOTRANSFERASE Length = 66 Score = 129 (54.3 bits), Expect = 8e-07 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 1/44 (2%)
 Query:    205 SLSGHKFNGLKGQGVLLVNHIQNIEPIIQGGGQEYGVRSGTVNL 248
               + SGHKF+ L G G LLV+    I P+I GGGQ+ GVRSGT NL
 Sbjct:    187 AFSGHKFHALSGIGALLVSSGVKISPLIWGGGQQGGVRSGTENL 230

>PD041942 (Closest domain: D3DID6_HYDTT 95-245) Number of domains in family: 11 Commentary (automatic): SUBNAME: FULL=NIFS-LIKE RECNAME: FULL=AMINOTRANSFERASE AMINOTRANSFERASE TRANSFERASE V CLASS FULL=BA71V-QP383R CLUSTER Length = 151 Score = 129 (54.3 bits), Expect = 2e-06 Identities = 40/139 (28%), Positives = 67/139 (48%), Gaps = 2/139 (1%)
 Query:    123 GFKVKYVDVTKDGTIDLQHFNDLMSDKVGLVTCMYVNNVTGQIQPIPQMAEVIKNY-PKA 181
               G  V Y+   + G ID +   + + +   +VT   V   T  ++ I  + +V+K   PK 
 Sbjct:    107 GLNVLYLTTDRYGWIDPELIREHVKEDTLMVTMGAVCRETAALRDIVGIVKVVKETNPKT 166

 Query:    182 HFHVDAVQAF-GKISMDFNNVDSISLSGHKFNGLKGQGVLLVNHIQNIEPIIQGGGQEYG 240
                 H D    +   + +D   +D  S  G    G +G G+L +     ++PII+GG QE G
 Sbjct:    167 LCHFDFWGLYYPDMVVDVELLDMASFDGPSLLGPQGVGILYLKKGIRLKPIIEGGTQERG 226

 Query:    241 VRSGTVNLPNDIAMVKAMK 259
               +R+G  NL    AM +++K
 Sbjct:    227 LRAGEENLFGIYAMSQSIK 245

>PDB020B7 (Closest domain: F7V8C1_CLOSS 1-103) Number of domains in family: 226 Commentary (automatic): SUBNAME: FULL=CYSTEINE DESULFURASE FAMILY PHOSPHATE PYRIDOXAL TRANSFERASE LYASE AMINOTRANSFERASE EC=2.8.1.7 Length = 103 Score = 126 (53.1 bits), Expect = 3e-06 Identities = 36/102 (35%), Positives = 51/102 (50%), Gaps = 5/102 (4%)
 Query:     10 LIYLDNAATT-KAFEEVLDTYLKVNQSMYYNPNSPHKXXXXXXXXXXXXKVQINDMVNTN 68
               +IYLDNAATT K  ++VLD  L   Q++       H             + +++D  +  
 Sbjct:      1 MIYLDNAATTLKKPKQVLDAVLTAMQTIGNAGRGVHGASLGAARTVFDTRKKVSDFFHAE 60

 Query:     69 MTYDVVFTSGATESNNIALKGVAYRKFDTAREIITSVLEHPS 110
                   V FT  +TE+ NIALKG+     +    +ITSVLEH S
 Sbjct:     61 GPSQVAFTCNSTEALNIALKGI----LNPGDHVITSVLEHNS 98

>PDA5C2J6 (Closest domain: G2LI14_CHLTF 328-384) Number of domains in family: 207 Commentary (automatic): SUBNAME: TRANSFERASE PHOSPHATE PYRIDOXAL DESULFURASE FULL=CYSTEINE AMINOTRANSFERASE EC=2.8.1.7 LYASE FULL=PUTATIVE Length = 57 Score = 113 (48.1 bits), Expect = 0.0001 Identities = 24/47 (51%), Positives = 30/47 (63%), Gaps = 1/47 (2%)
 Query:    325 ISTTSACSSKRNKLNEVLAAMGLSDKSIEGSIRLSFGATTTKEDIAR 371
               +ST SACSS   + + VL AMGL  + + GSIR+S    TT  DIAR
 Sbjct:    329 VSTGSACSSGTTEPSHVLRAMGLPPERVRGSIRVSLSQETTAADIAR 375

>PDA1S6D5 (Closest domain: D2ZRZ4_METSM 219-272) Number of domains in family: 242 Commentary (automatic): SUBNAME: PHOSPHATE PYRIDOXAL TRANSFERASE DESULFURASE FULL=CYSTEINE LYASE AMINOTRANSFERASE EC=2.8.1.7 FULL=AMINOTRANSFERASE Length = 54 Score = 112 (47.8 bits), Expect = 0.0001 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Query:    230 PIIQGGGQEYGVRSGTVNLPNDIAMVKAMKMANENLEALNAFVTELNNDV 279
               P+I GGGQE G+RSGT N+P  +   KA ++AN NLE   A + +  +++
 Sbjct:    219 PLIHGGGQERGIRSGTENVPGIVGFGKACEIANNNLEENYARLVKTRDEI 268

>PDA9Z7A1 (Closest domain: Q9RME8_ZYMMB 311-368) Number of domains in family: 1431 Commentary (automatic): PYRIDOXAL PHOSPHATE FULL=CYSTEINE TRANSFERASE DESULFURASE SUBNAME: EC=2.8.1.7 RECNAME: AMINOTRANSFERASE FULL=PUTATIVE Length = 58 Score = 111 (47.4 bits), Expect = 0.0002 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 6/41 (14%)
 Query:    329 SACSSKRNKLNEVLAAMGLSDKSIEGSIRLSFGATTTKEDI 369
               SACSS   + + VL A+GLS K++ GSIR+ FG  TT+E++
 Sbjct:    311 SACSSGNGRPSHVLKALGLSQKAVRGSIRIGFGRYTTEEEL 351

>PDC56346 (Closest domain: Q9ZD59_RICPR 147-206) Number of domains in family: 3 Commentary (automatic): SUBNAME: LYASE FULL=SELENOCYSTEINE HOMOLOG REFERENCE PHOSPHATE PYRIDOXAL FULL=NIFS SPL1 CSF1 Length = 60 Score = 106 (45.4 bits), Expect = 0.0008 Identities = 25/61 (40%), Positives = 37/61 (60%), Gaps = 3/61 (4%)
 Query:    163 GQIQPIPQMAEVIKNYPKAHFHVDAVQAFGKISMDFNN--VDSISLSGHKFNGLKGQGVL 220
               G +Q I  ++++ K Y  A FH D VQ+FGKIS++     +D  ++SGHK  G  G G L
 Sbjct:    147 GVLQDIAAISKITKKY-NAKFHSDLVQSFGKISLNIKELGLDFATISGHKIGGGHGCGAL 205

 Query:    221 L 221
               +
 Sbjct:    206 I 206

>PD892055 (Closest domain: B7JA84_ACIF2 95-153) Number of domains in family: 908 Commentary (automatic): PHOSPHATE PYRIDOXAL SUBNAME: TRANSFERASE DESULFURASE FULL=CYSTEINE EC=2.8.1.7 AMINOTRANSFERASE RECNAME: CLASS Length = 59 Score = 101 (43.5 bits), Expect = 0.003 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 8/58 (13%)
 Query:    103 TSVLEHPSXXXXXXXXXXXXGFKVKYVDVTKDGTIDLQHFNDLMSDKVGLVTCMYVNN 160
               TSV+EHP+            G+KV Y+ V + G I ++ +   +S++V +V+ MY NN
 Sbjct:     95 TSVVEHPAILSLCDHLERHEGYKVHYIPVDRLGRISMEAYAAALSEQVAVVSMMYANN 152

>PD715843 (Closest domain: A0LM34_SYNFM 70-113) Number of domains in family: 112 Commentary (automatic): SUBNAME: DESULFURASE TRANSFERASE PHOSPHATE PYRIDOXAL FULL=CYSTEINE EC=2.8.1.7 AMINOTRANSFERASE RECNAME: V Length = 44 Score = 99 (42.7 bits), Expect = 0.006 Identities = 20/35 (57%), Positives = 25/35 (71%), Gaps = 2/35 (5%)
 Query:     76 TSGATESNNIALKGVAYRKFDTAREIITSVLEHPS 110
               TSG TESNN A+KG+A+        IITSV+EHP+
 Sbjct:     70 TSGGTESNNHAIKGIAFANRARGNHIITSVIEHPA 104