Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PDB00502 score=146 PDC8A720 score=99 PD477895 score=179 PDA1F9O4 score=146 PD864105 score=161 PDC636W1 score=166


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PD477895
PDC636W1
PD864105
PDA1F9O4
PDB00502
PDC65576
PDC8A720

Domain 3D modelling using Swiss-Model

Domain IDBEGINEND 
PD477895
PDC636W1
PD864105
PDA1F9O4
PDB00502

Domain 3D modelling using Geno3D

Domain IDBEGINEND 
PD477895
PDC636W1
PD864105
PDA1F9O4
PDB00502


HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(197 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

      2-29  #PDB00502                                            146 2e-10
     23-70  #PDC8A720                                             99 0.001
     36-70  #PD477895                                            179 7e-15
     37-70  #PDC65576                                            138 2e-09
    71-120  #PDA1F9O4                                            146 3e-10
   121-151  #PD864105                                            161 2e-12
   164-196  #PDC636W1                                            166 5e-13


>PD477895 (Closest domain: Y102_STAA3 94-128)
Number of domains in family: 540
Commentary (automatic):
MEMBRANE LIPOPROTEIN CELL SUBNAME: FULL=PUTATIVE UNCHARACTERIZED PRECURSOR FLAGS: SIGNAL TANDEM  
Length = 35
Score = 179  (73.6 bits), Expect = 7e-15
Identities = 35/35 (100%), Positives = 35/35 (100%)

 Query:     36 MNRNTKTTKGYYYVNAIKNDKDGRPQENEKRYPVK 70
               MNRNTKTTKGYYYVNAIKNDKDGRPQENEKRYPVK
 Sbjct:     94 MNRNTKTTKGYYYVNAIKNDKDGRPQENEKRYPVK 128

>PDC636W1 (Closest domain: Y054_STAA8 214-254) Number of domains in family: 830 Commentary (automatic): MEMBRANE LIPOPROTEIN CELL SUBNAME: FULL=PUTATIVE UNCHARACTERIZED PRECURSOR FLAGS: SIGNAL TANDEM Length = 41 Score = 166 (68.6 bits), Expect = 5e-13 Identities = 33/33 (100%), Positives = 33/33 (100%)
 Query:    164 SSVGYKDIEFTFVEKKEENIYFSDGLIFKPSED 196
               SSVGYKDIEFTFVEKKEENIYFSDGLIFKPSED
 Sbjct:    222 SSVGYKDIEFTFVEKKEENIYFSDGLIFKPSED 254

>PD864105 (Closest domain: D9RQH5_STAAK 180-214) Number of domains in family: 915 Commentary (automatic): MEMBRANE LIPOPROTEIN CELL SUBNAME: FULL=PUTATIVE UNCHARACTERIZED PRECURSOR FLAGS: SIGNAL TANDEM Length = 35 Score = 161 (66.6 bits), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Query:    121 PSYSAKYQLTNDDYNVKQLRKRYDIPTNKAP 151
               PSYSAKYQLTNDDYNVKQLRKRYDIPTNKAP
 Sbjct:    180 PSYSAKYQLTNDDYNVKQLRKRYDIPTNKAP 210

>PDA1F9O4 (Closest domain: D6T577_STAAU 129-178) Number of domains in family: 932 Commentary (automatic): MEMBRANE LIPOPROTEIN CELL SUBNAME: FULL=PUTATIVE UNCHARACTERIZED PRECURSOR FLAGS: SIGNAL TANDEM Length = 50 Score = 146 (60.8 bits), Expect = 3e-10 Identities = 32/50 (64%), Positives = 32/50 (64%)
 Query:     71 MVDNKIIPTXXXXXXXXXXXXXXXXXXVQYGNFKDLSKYKDGDISYNPEV 120
               MVDNKIIPT                  VQYGNFKDLSKYKDGDISYNPEV
 Sbjct:    129 MVDNKIIPTKEIKDKNIKKEIENFKFFVQYGNFKDLSKYKDGDISYNPEV 178

>PDB00502 (Closest domain: Y081_STAAC 61-88) Number of domains in family: 636 Commentary (automatic): MEMBRANE LIPOPROTEIN CELL SUBNAME: FULL=PUTATIVE UNCHARACTERIZED PRECURSOR FLAGS: SIGNAL TANDEM Length = 28 Score = 146 (60.8 bits), Expect = 2e-10 Identities = 28/28 (100%), Positives = 28/28 (100%)
 Query:      2 TKFDKNDKGTWIIGSEMATQNKGEALKV 29
               TKFDKNDKGTWIIGSEMATQNKGEALKV
 Sbjct:     61 TKFDKNDKGTWIIGSEMATQNKGEALKV 88

>PDC65576 (Closest domain: G8RFJ5_STAAU 94-127) Number of domains in family: 146 Commentary (automatic): MEMBRANE LIPOPROTEIN SUBNAME: CELL FULL=PUTATIVE UNCHARACTERIZED TANDEM PRECURSOR FLAGS: SIGNAL Length = 34 Score = 138 (57.8 bits), Expect = 2e-09 Identities = 25/34 (73%), Positives = 31/34 (91%)
 Query:     37 NRNTKTTKGYYYVNAIKNDKDGRPQENEKRYPVK 70
               NRNT++ KG+YYVNAIKND+DGRPQ+N+  YPVK
 Sbjct:     94 NRNTRSAKGFYYVNAIKNDEDGRPQDNQIEYPVK 127

>PDC8A720 (Closest domain: D9RKY9_STAAK 90-138) Number of domains in family: 5 Commentary (automatic): MEMBRANE LIPOPROTEIN CELL SUBNAME: TANDEM FULL=STAPHYLOCOCCAL FULL=UNCHARACTERIZED FULL=HYPOTHETICAL PRECURSOR PALMITATE Length = 49 Score = 99 (42.7 bits), Expect = 0.001 Identities = 19/48 (39%), Positives = 33/48 (68%), Gaps = 2/48 (4%)
 Query:     23 KGEALKVKGMVLYMNRNTKTTKGYYYVNAIKNDKDGRPQENEKRYPVK 70
               KG+ +K +GM LY+NRNT+T KG++ +  I  + +   ++ E++Y VK
 Sbjct:     91 KGKVMKTRGMQLYINRNTETAKGFFVLKEISENNNRVNKDKEEKYEVK 138