Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PD006143 score=483


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PD006143
PDB078E7

Domain 3D modelling using Swiss-Model

Domain IDBEGINEND 
PD006143

Domain 3D modelling using Geno3D

Domain IDBEGINEND 
PD006143


HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(100 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

      1-92  #PD006143                                            483 1e-60
     31-79  #PDB078E7                                            108 1e-05


>PD006143 (Closest domain: NRDI_STAAW 3-124)
Number of domains in family: 927
Commentary (automatic):
NRDI FULL=PROTEIN RECNAME: SUBNAME: FULL=NRDI FULL=RIBONUCLEOTIDE REDUCTASE STIMULATORY FULL=PUTATIVE UNCHARACTERIZED  
Length = 122
Score = 483  (190.7 bits), Expect = 1e-60
Identities = 92/92 (100%), Positives = 92/92 (100%)

 Query:      1 MEPVHEPFIIVTGTIGFGEVPEPVQSFLEVNHQYIRGVAASGNRNWGLNFAKAGRTISEE 60
               MEPVHEPFIIVTGTIGFGEVPEPVQSFLEVNHQYIRGVAASGNRNWGLNFAKAGRTISEE
 Sbjct:     33 MEPVHEPFIIVTGTIGFGEVPEPVQSFLEVNHQYIRGVAASGNRNWGLNFAKAGRTISEE 92

 Query:     61 YNVPLLMKFELHGKNKDVIEFKNKVGNFNENH 92
               YNVPLLMKFELHGKNKDVIEFKNKVGNFNENH
 Sbjct:     93 YNVPLLMKFELHGKNKDVIEFKNKVGNFNENH 124

>PDB078E7 (Closest domain: H2A510_STRMC 91-143) Number of domains in family: 45 Commentary (automatic): SUBNAME: FULL=RIBONUCLEOTIDE REDUCTASE FULL=PUTATIVE NRDI FULL=NRDI REDUCTION FAMILY UNCHARACTERIZED RIBONUCLEOTIDE Length = 53 Score = 108 (46.2 bits), Expect = 1e-05 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 10/49 (20%)
 Query:     31 NHQYIRGVAASGNRNWGLNFAKAGRTISEEYNVPLLMKFELHGKNKDVI 79
               N +Y  G+  SGNRN+   F       SEE+  P+L +FEL G  +DVI
 Sbjct:     92 NSKYCMGIIGSGNRNFNKQFCLTAHQYSEEFGFPVLDEFELRGTEEDVI 140