Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PD070949 score=259 PDB6K6V3 score=127 PDB9P0F4 score=107 PD015391 score=147


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PD070949
PD015391
PDC7H8T1
PDB6K6V3
PDB9P0F4



HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(143 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

     20-71  #PD070949                                            259 4e-27
     43-75  #PDB6K6V3                                            127 5e-08
     44-85  #PDB9P0F4                                            107 3e-05
   115-142  #PDC7H8T1                                            144 2e-10
   115-143  #PD015391                                            147 8e-11


>PD070949 (Closest domain: Q7A419_STAAN 17-68)
Number of domains in family: 216
Commentary (automatic):
SUBNAME: FULL=PUTATIVE UNCHARACTERIZED MEMBRANE FULL=HYPOTHETICAL YVLA REFERENCE FULL=UNCHARACTERIZED FULL=CONSERVED FULL=INTEGRAL  
Length = 52
Score = 259  (104.4 bits), Expect = 4e-27
Identities = 52/52 (100%), Positives = 52/52 (100%)

 Query:     20 SNDENIMAMLIYLLSLFTSIIGPLIIWLLKKDESKLVDRAGKNYLNYTISYI 71
               SNDENIMAMLIYLLSLFTSIIGPLIIWLLKKDESKLVDRAGKNYLNYTISYI
 Sbjct:     17 SNDENIMAMLIYLLSLFTSIIGPLIIWLLKKDESKLVDRAGKNYLNYTISYI 68

>PD015391 (Closest domain: F4FJY9_STAAU 112-140) Number of domains in family: 225 Commentary (automatic): SUBNAME: FULL=PUTATIVE UNCHARACTERIZED MEMBRANE FULL=CONSERVED FULL=UNCHARACTERIZED REFERENCE PRECURSOR FLAGS: TRANSMEMBRANE Length = 29 Score = 147 (61.2 bits), Expect = 8e-11 Identities = 29/29 (100%), Positives = 29/29 (100%)
 Query:    115 ILSFVFTIIACVKYYNGQEYIIPLTIRFI 143
               ILSFVFTIIACVKYYNGQEYIIPLTIRFI
 Sbjct:    112 ILSFVFTIIACVKYYNGQEYIIPLTIRFI 140

>PDC7H8T1 (Closest domain: D1GS02_STAA0 112-139) Number of domains in family: 8 Commentary (automatic): SUBNAME: FULL=PUTATIVE UNCHARACTERIZED MEMBRANE Length = 28 Score = 144 (60.1 bits), Expect = 2e-10 Identities = 28/28 (100%), Positives = 28/28 (100%)
 Query:    115 ILSFVFTIIACVKYYNGQEYIIPLTIRF 142
               ILSFVFTIIACVKYYNGQEYIIPLTIRF
 Sbjct:    112 ILSFVFTIIACVKYYNGQEYIIPLTIRF 139

>PDB6K6V3 (Closest domain: Q49ZM1_STAS1 42-74) Number of domains in family: 48 Commentary (automatic): SUBNAME: UNCHARACTERIZED FULL=PUTATIVE FULL=CONSERVED MEMBRANE PRECURSOR REFERENCE FLAGS: MODIFICATION GTPASE Length = 33 Score = 127 (53.5 bits), Expect = 5e-08 Identities = 22/33 (66%), Positives = 29/33 (87%)
 Query:     43 LIIWLLKKDESKLVDRAGKNYLNYTISYIIWSI 75
               LIIWL+K+++S  VDRAGKNY N+ +SY+IWSI
 Sbjct:     42 LIIWLIKREDSPFVDRAGKNYFNFLLSYVIWSI 74

>PDB9P0F4 (Closest domain: B8CVF0_SHEPW 25-75) Number of domains in family: 126 Commentary (automatic): SUBNAME: FULL=PUTATIVE UNCHARACTERIZED MEMBRANE FULL=UNCHARACTERIZED TRANSMEMBRANE REFERENCE FULL=CONSERVED FULL=HYPOTHETICAL PRECURSOR Length = 51 Score = 107 (45.8 bits), Expect = 3e-05 Identities = 19/42 (45%), Positives = 31/42 (73%)
 Query:     44 IIWLLKKDESKLVDRAGKNYLNYTISYIIWSIVLVVITLIGV 85
               I+WL+K+DE   VD  G+N LN+ IS  I++++ VV+ L+G+
 Sbjct:     25 IVWLMKRDELPFVDSCGRNCLNFKISIAIYAMISVVLMLVGI 66