Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PD655387 score=505


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PD655387



HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(133 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

      1-98  #PD655387                                            505 1e-63


>PD655387 (Closest domain: Q8NVL4_STAAW 40-142)
Number of domains in family: 9
Commentary (automatic):
SUBNAME: FULL=PUTATIVE MEMBRANE UNCHARACTERIZED FULL=HYPOTHETICAL PEROTEIN REFERENCE  
Length = 103
Score = 505  (199.1 bits), Expect = 1e-63
Identities = 98/98 (100%), Positives = 98/98 (100%)

 Query:      1 MGNKQCISLNLLLSDDTFAVISVMTTLGTAILGGIAPSIYGIFTSPIDKKSSFRAISDWE 60
               MGNKQCISLNLLLSDDTFAVISVMTTLGTAILGGIAPSIYGIFTSPIDKKSSFRAISDWE
 Sbjct:     40 MGNKQCISLNLLLSDDTFAVISVMTTLGTAILGGIAPSIYGIFTSPIDKKSSFRAISDWE 99

 Query:     61 QEQRNNVKDLMMLLPFTLLSILIVIFIFQFAYSKLFNT 98
               QEQRNNVKDLMMLLPFTLLSILIVIFIFQFAYSKLFNT
 Sbjct:    100 QEQRNNVKDLMMLLPFTLLSILIVIFIFQFAYSKLFNT 137