Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PD526846 score=212 PD786156 score=303 PDA1V4U2 score=205 PDA857M8 score=203 PD482214 score=182 PDA9T8H7 score=200 PD827414 score=189 PDA1F5E7 score=377


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PDA1F5E7
PD786156
PD387799
PD526846
PDA1V4U2
PDA2K3G9
PDA857M8
PDA9T8H7
PD827414
PD414066
PD482214
PDC657H6
PDB5H8I3
PDC7L8T4
PDC677U8
PDC66453
PDA026V7
PDC653O7
PDC6Y626
PDA210O4
PDB3L707
PDD351N1
PDC650L5
PDA346P1
PD709608
PDC69598
PD925716
PDD9Q131
PDA1P539
PDB003Y9
PDB0H284
PDB1O9V8
PDC422M4
PDB021T5

Domain 3D modelling using Swiss-Model

Domain IDBEGINEND 
PD786156
PD526846
PDA1V4U2
PDA2K3G9
PD414066
PD482214
PDB5H8I3
PDD9Q131

Domain 3D modelling using Geno3D

Domain IDBEGINEND 
PD786156
PD526846
PDA1V4U2
PDA2K3G9
PD414066
PD482214
PDB5H8I3
PDD9Q131


HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(404 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

      1-54  #PD526846                                            212 2e-18
      1-38  #PDC6Y626                                            140 2e-08
     4-202  #PDD351N1                                            110 0.002
     36-65  #PDC653O7                                            143 5e-09
    39-102  #PD786156                                            303 5e-31
     47-71  #PDC69598                                            102 0.002
    57-201  #PDC7L8T4                                            173 5e-12
     69-99  #PDC650L5                                            108 0.0003
    71-118  #PD925716                                            101 0.004
    71-137  #PDA1V4U2                                            205 2e-17
    71-117  #PDB3L707                                            121 6e-06
    74-128  #PDA1P539                                            101 0.004
    74-114  #PDB5H8I3                                            175 3e-13
    76-131  #PDA210O4                                            125 3e-06
    88-145  #PDD9Q131                                            101 0.004
    90-185  #PDB003Y9                                            101 0.005
   101-161  #PDA2K3G9                                            203 4e-17
   106-158  #PDC66453                                            165 9e-12
   106-202  #PDA857M8                                            203 2e-16
   116-155  #PDC657H6                                            177 1e-13
   117-162  #PDA026V7                                            149 1e-09
   118-162  #PD414066                                            184 2e-14
   130-190  #PDA346P1                                            106 0.001
   131-202  #PDB0H284                                             99 0.009
   142-199  #PDB1O9V8                                             99 0.008
   143-203  #PDC677U8                                            170 2e-12
   154-202  #PDC422M4                                             99 0.006
   164-203  #PD482214                                            182 3e-14
   170-200  #PDB021T5                                             97 0.009
   172-203  #PD709608                                            104 0.001
   260-305  #PDA9T8H7                                            200 1e-16
   268-307  #PD827414                                            189 2e-15
   311-397  #PDA1F5E7                                            377 3e-41
   325-393  #PD387799                                            289 4e-29


>PDA1F5E7 (Closest domain: C4Z926_EUBR3 324-410)
Number of domains in family: 442
Commentary (automatic):
SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 AMMONIA-LYASE FULL=L-THREONINE REFERENCE FULL=PUTATIVE THREONINE  
Length = 87
Score = 377  (149.8 bits), Expect = 3e-41
Identities = 68/87 (78%), Positives = 81/87 (93%)

 Query:    311 SIVQHGLIQRDRIFSVSVLLPDKPGELVQVAQTIAEAQGNVIKLEHNQFVSTNRNAAVEL 370
               S+VQ GLI RDRIF+VSVLLPDKPGEL +V+QT+A+ QGNVIKLEHNQFV+TNR+AAVEL
 Sbjct:    324 SVVQQGLIFRDRIFTVSVLLPDKPGELAKVSQTLADVQGNVIKLEHNQFVTTNRSAAVEL 383

 Query:    371 RITMEAFGTEHKQEILKALEKKGYRPR 397
               RIT+E FGTEHK++I+ ALEKKGY+PR
 Sbjct:    384 RITLECFGTEHKEQIIAALEKKGYKPR 410

>PD786156 (Closest domain: G2SXN8_ROSHA 39-102) Number of domains in family: 1947 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC DEHYDRATASE AMMONIA-LYASE THREONINE FULL=L-THREONINE Length = 64 Score = 303 (121.3 bits), Expect = 5e-31 Identities = 56/64 (87%), Positives = 60/64 (93%)
 Query:     39 LKPENMQHTGAYKIRGAYYKISTLSDEERGRGLITASAGNHAQGVAFAAKKFGCKAVIVM 98
               LKPENMQ TGAYK+RGAYYKISTLSDEER +GLITASAGNHAQGVA+AAK +GCKAVIVM
 Sbjct:     39 LKPENMQFTGAYKVRGAYYKISTLSDEERAKGLITASAGNHAQGVAYAAKCYGCKAVIVM 98

 Query:     99 PTVT 102
               PT T
 Sbjct:     99 PTTT 102

>PD387799 (Closest domain: G2SXN8_ROSHA 325-393) Number of domains in family: 477 Commentary (automatic): SUBNAME: KINASE FULL=GTP TRANSFERASE EC=2.7.6.5 PYROPHOSPHOKINASE SYNTHETASE FULL=PPPGPP SPOT/RELA I Length = 69 Score = 289 (115.9 bits), Expect = 4e-29 Identities = 54/69 (78%), Positives = 64/69 (92%)
 Query:    325 SVSVLLPDKPGELVQVAQTIAEAQGNVIKLEHNQFVSTNRNAAVELRITMEAFGTEHKQE 384
               +VSVLLPDKPGEL +V+  IA  QGNVIKLEHNQFV+TNR+AAVELRIT+E+FGTEHK++
 Sbjct:    325 TVSVLLPDKPGELSKVSAAIAAEQGNVIKLEHNQFVTTNRSAAVELRITLESFGTEHKKQ 384

 Query:    385 ILKALEKKG 393
               I+KALEKKG
 Sbjct:    385 IMKALEKKG 393

>PD526846 (Closest domain: D4J3Q9_BUTFI 1-54) Number of domains in family: 939 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 AMMONIA-LYASE FULL=L-THREONINE CATABOLIC THREONINE BETA Length = 54 Score = 212 (86.3 bits), Expect = 2e-18 Identities = 39/54 (72%), Positives = 48/54 (88%)
 Query:      1 MMTLEKFEEASELVKKVTNSTKLVYSDYLSEQSGGKVYLKPENMQHTGAYKIRG 54
               M+TL+KFEEAS++V +VT+ TKL+YSDY SE+SG  VYLKPENMQ TGAYK+RG
 Sbjct:      1 MLTLDKFEEASKIVTEVTHETKLIYSDYFSEKSGNDVYLKPENMQLTGAYKLRG 54

>PDA1V4U2 (Closest domain: A8MDC1_CALMQ 86-152) Number of domains in family: 465 Commentary (automatic): SUBNAME: LYASE AMMONIA-LYASE FULL=DIAMINOPROPIONATE EC=4.3.1.15 FULL=PUTATIVE FULL=THREONINE SYNTHASE DEHYDRATASE EC=4.3.1.19 Length = 67 Score = 205 (83.6 bits), Expect = 2e-17 Identities = 39/67 (58%), Positives = 50/67 (74%)
 Query:     71 LITASAGNHAQGVAFAAKKFGCKAVIVMPTVTPLIKVNRTKSYGAEVILHGDVYDDAYAY 130
               ++TASAGNHAQGVA+ AK +G K+ IVMP  TP IK++ T+ YGAEVIL G  Y +A  Y
 Sbjct:     86 VVTASAGNHAQGVAYVAKIYGLKSTIVMPKYTPWIKISNTRKYGAEVILEGQSYYEAEKY 145

 Query:    131 ACELAEK 137
               A EL ++
 Sbjct:    146 AIELTKE 152

>PDA2K3G9 (Closest domain: F2JGM5_CELLD 106-167) Number of domains in family: 166 Commentary (automatic): SUBNAME: LYASE AMMONIA-LYASE FULL=DIAMINOPROPIONATE FULL=PUTATIVE EC=4.3.1.15 DEHYDRATASE UNCHARACTERIZED ALTNAME: EC=4.3.1.19 Length = 62 Score = 203 (82.8 bits), Expect = 4e-17 Identities = 37/61 (60%), Positives = 47/61 (77%)
 Query:    101 VTPLIKVNRTKSYGAEVILHGDVYDDAYAYACELAEKEGYTFVHPFNDIDVATGQGTIAM 160
                TPLIKV  TK++GA V+L G VYD+AY  A +L ++ GYTF+HPFND +V  GQGTIA+
 Sbjct:    107 TTPLIKVQATKNWGAHVVLAGQVYDEAYETAKKLEQENGYTFIHPFNDKEVMAGQGTIAL 166

 Query:    161 E 161
               E
 Sbjct:    167 E 167

>PDA857M8 (Closest domain: D1C1H4_SPHTD 113-225) Number of domains in family: 57 Commentary (automatic): SUBNAME: BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT LYASE FULL=THREONINE FULL=PUTATIVE EC=4.3.1.19 DEHYDRATASE UNCHARACTERIZED Length = 113 Score = 203 (82.8 bits), Expect = 2e-16 Identities = 40/97 (41%), Positives = 63/97 (64%)
 Query:    106 KVNRTKSYGAEVILHGDVYDDAYAYACELAEKEGYTFVHPFNDIDVATGQGTIAMEIVQE 165
               KV   +  GAEV+L G  +D+A   A E AE++G  ++H  N+ D+  G GT A+E+++ 
 Sbjct:    116 KVASMRRLGAEVVLTGRDFDEARLAAEERAERDGMRYIHSANEPDLIAGVGTYALEMIEA 175

 Query:    166 LPTVDYILVPIGGGGLVSGVATLAKMLNPKIKVIGVE 202
               +P +D ++VP+G G  V G A + K +NP I+VIGV+
 Sbjct:    176 VPDLDTVIVPVGAGSGVCGTAIVMKAVNPAIRVIGVQ 212

>PDA9T8H7 (Closest domain: C4Z0E4_EUBE2 249-307) Number of domains in family: 658 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC DEHYDRATASE AMMONIA-LYASE FULL=L-THREONINE DEAMINASE Length = 59 Score = 200 (81.6 bits), Expect = 1e-16 Identities = 39/46 (84%), Positives = 42/46 (91%)
 Query:    260 IGAFLDMVENHKMIVENSGLLSVAALKQLDCKGKKVVCVLSGGNMD 305
               I AFLDMVENHKMIVENSGLL+VAALKQLD K KK+V +LSGGNMD
 Sbjct:    262 IVAFLDMVENHKMIVENSGLLTVAALKQLDVKDKKIVSILSGGNMD 307

>PD827414 (Closest domain: E0RV38_BUTPB 273-312) Number of domains in family: 1184 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 AMMONIA-LYASE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA SUBUNIT FULL=L-THREONINE Length = 40 Score = 189 (77.4 bits), Expect = 2e-15 Identities = 35/40 (87%), Positives = 38/40 (95%), Gaps = 1/40 (2%)
 Query:    268 ENHKMIVENSGLLSVAALKQLDCKGKKVVCVLSGGNMDVI 307
               ENHKM+VENSGLLSVAALKQLDCK KK+ CVLSGGNMD+I
 Sbjct:    273 ENHKMVVENSGLLSVAALKQLDCKDKKIACVLSGGNMDII 312

>PD414066 (Closest domain: C4Z926_EUBR3 131-176) Number of domains in family: 1521 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC AMMONIA-LYASE FULL=L-THREONINE DEHYDRATASE DEAMINASE Length = 46 Score = 184 (75.5 bits), Expect = 2e-14 Identities = 35/45 (77%), Positives = 41/45 (91%), Gaps = 1/45 (2%)
 Query:    118 ILHGDVYDDAYAYACELAEKEGYTFVHPFNDIDVATGQGTIAMEI 162
               +L+GDVYD+A A A ELAEKEGYTF+HPF+D+ VATGQGTIAMEI
 Sbjct:    131 VLYGDVYDEACAKAYELAEKEGYTFIHPFDDLAVATGQGTIAMEI 175

>PD482214 (Closest domain: D9R050_CLOSW 164-215) Number of domains in family: 1906 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC AMMONIA-LYASE FULL=PUTATIVE DEHYDRATASE FULL=L-THREONINE Length = 52 Score = 182 (74.7 bits), Expect = 3e-14 Identities = 35/40 (87%), Positives = 38/40 (95%), Gaps = 1/40 (2%)
 Query:    164 QELPTVDYILVPIGGGGLVSGVATLAKMLNPKIKVIGVEP 203
               +ELPTVDYILVPIGGGGL +GV+ LAKMLNPKIKVIGVEP
 Sbjct:    164 KELPTVDYILVPIGGGGLCTGVSVLAKMLNPKIKVIGVEP 203

>PDC657H6 (Closest domain: A6LTQ6_CLOB8 116-155) Number of domains in family: 135 Commentary (automatic): SUBNAME: FULL=THREONINE LYASE EC=4.3.1.19 DEHYDRATASE AMMONIA-LYASE FULL=L-THREONINE BIOSYNTHETIC EC=4.3.1.17 DEHYDRATASE Length = 40 Score = 177 (72.8 bits), Expect = 1e-13 Identities = 31/40 (77%), Positives = 37/40 (92%), Gaps = 1/40 (2%)
 Query:    116 EVILHGDVYDDAYAYACELAEKEGYTFVHPFNDIDVATGQ 155
               EVILHGDVYD+A  YA +LAE+EGYTF+HPF+D+DVATGQ
 Sbjct:    116 EVILHGDVYDEACNYALKLAEEEGYTFIHPFDDLDVATGQ 155

>PDB5H8I3 (Closest domain: A6LTQ6_CLOB8 74-114) Number of domains in family: 262 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 FULL=PUTATIVE BETA FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT SUBUNIT AMMONIA-LYASE Length = 41 Score = 175 (72.0 bits), Expect = 3e-13 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Query:     74 ASAGNHAQGVAFAAKKFGCKAVIVMPTVTPLIKVNRTKSYG 114
               ASAGNHAQGVA+AAK +  KA+IVMPT TPL+KVNRTK+YG
 Sbjct:     74 ASAGNHAQGVAYAAKAYNTKAIIVMPTTTPLMKVNRTKAYG 114

>PDC7L8T4 (Closest domain: F4X1E4_ACREC 167-321) Number of domains in family: 8 Commentary (automatic): SUBNAME: SYNTHETASE AMINOACYL-TRNA FULL=PUTATIVE UNCHARACTERIZED NUCLEOTIDE-BINDING FULL=BIFUNCTIONAL ATP-BINDING LIGASE BIOSYNTHESIS Length = 155 Score = 173 (71.2 bits), Expect = 5e-12 Identities = 44/148 (29%), Positives = 81/148 (54%), Gaps = 3/148 (2%)
 Query:     57 YKISTLSDEERGRGLITASAGNHAQGVAFAAKKFGCKAVIVMPTVTPLIKVNRTKSYG-A 115
               Y +  LS E++ +G++T S+G+ A  +     +F     +V+PT T   K+   ++Y  +
 Sbjct:    167 YSLLHLSKEQKCKGVVTISSGSFAFILCHYTHRFKIPVTVVLPTTTLEEKIKMYQTYPLS 226

 Query:    116 EVILHGDVYDDAYAYACELAEKEGYTFVHPFNDIDVATGQGTIAMEIVQELPTVDYILVP 175
                VI+ GD   +A+  A ++A +E   ++   +  ++  GQ T+ +EIV++   +D +L+P
 Sbjct:    227 RVIVRGDTLLEAHYNALDIAMREDLFYLDGNDHPNMIIGQATLGIEIVRQQSQIDVVLLP 286

 Query:    176 --IGGGGLVSGVATLAKMLNPKIKVIGV 201
                 I G GL + +A   K  N KI VI +
 Sbjct:    287 TTIKGCGLTTAIAIAIKGCNSKITVIHI 314

>PDC677U8 (Closest domain: G0QLH3_ICHMG 45-113) Number of domains in family: 81 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC DEHYDRATASE THREONINE FULL=PUTATIVE ILVA Length = 69 Score = 170 (70.1 bits), Expect = 2e-12 Identities = 31/64 (48%), Positives = 46/64 (71%), Gaps = 3/64 (4%)
 Query:    143 VHPFNDIDVATGQGTIAMEIVQELPT---VDYILVPIGGGGLVSGVATLAKMLNPKIKVI 199
               VHP+ND  V  GQGTI++EI +++ +   +D+I+VP+GGGGL+SG     K ++PK KV+
 Sbjct:     46 VHPYNDFAVIQGQGTISLEIFEQICSENFIDFIIVPVGGGGLLSGTCIATKGISPKTKVV 105

 Query:    200 GVEP 203
                 EP
 Sbjct:    106 AAEP 109

>PDC66453 (Closest domain: F8DDT5_HALXS 115-169) Number of domains in family: 110 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT FULL=PUTATIVE AMMONIA-LYASE Length = 55 Score = 165 (68.2 bits), Expect = 9e-12 Identities = 30/53 (56%), Positives = 40/53 (75%), Gaps = 3/53 (5%)
 Query:    106 KVNRTKSYGAEVILHGDVYDDAYAYACELAEKEGYTFVHPFNDIDVATGQGTI 158
               K+  T+ YGAEVI+ GD+Y+ +YAYA E A++ G TFVHPF+D  +  GQGTI
 Sbjct:    116 KIEATRGYGAEVIVEGDIYERSYAYALERADETGETFVHPFDDEAIVAGQGTI 168

>PDA026V7 (Closest domain: D9RYW0_THEOJ 118-163) Number of domains in family: 680 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA SUBUNIT FULL=PUTATIVE AMMONIA-LYASE Length = 46 Score = 149 (62.0 bits), Expect = 1e-09 Identities = 28/46 (60%), Positives = 35/46 (76%), Gaps = 4/46 (8%)
 Query:    117 VILHGDVYDDAYAYACELAEKEGYTFVHPFNDIDVATGQGTIAMEI 162
               V+LHG VYD+AYA A ++ E+ G TF+HPFND  V  GQGTI +EI
 Sbjct:    118 VVLHGSVYDEAYAMAKKIQEETGATFIHPFNDPLVIAGQGTIGLEI 163

>PDC653O7 (Closest domain: D9R050_CLOSW 36-65) Number of domains in family: 155 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA SUBUNIT LYASE FULL=THREONINE FULL=PUTATIVE DEPENDENT FULL=PYRIDOXAL-PHOSPHATE Length = 30 Score = 143 (59.7 bits), Expect = 5e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 1/30 (3%)
 Query:     36 KVYLKPENMQHTGAYKIRGAYYKISTLSDE 65
               KVY KPENMQ+TGAYK+RGAYYKISTLS E
 Sbjct:     36 KVYFKPENMQYTGAYKVRGAYYKISTLSQE 65

>PDC6Y626 (Closest domain: C4Z926_EUBR3 14-51) Number of domains in family: 14 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE EC=4.3.1.19 LYASE AMMONIA-LYASE FULL=L-THREONINE DEHYDRATASE FULL=ILVE1 FULL=PUTATIVE Length = 38 Score = 140 (58.5 bits), Expect = 2e-08 Identities = 27/38 (71%), Positives = 34/38 (89%), Gaps = 1/38 (2%)
 Query:      1 MMTLEKFEEASELVKKVTNSTKLVYSDYLSEQSGGKVY 38
               M+TL+KFEEASE VK+VT  TKL+YSD+LS+Q+G KVY
 Sbjct:     14 MLTLDKFEEASEKVKEVTLETKLIYSDFLSDQTGNKVY 51

>PDA210O4 (Closest domain: F0ZP75_DICPU 85-141) Number of domains in family: 232 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=PUTATIVE FULL=L-SERINE LYASE UNCHARACTERIZED EC=4.3.1.19 EC=4.3.1.17 BETA FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT Length = 57 Score = 125 (52.8 bits), Expect = 3e-06 Identities = 24/56 (42%), Positives = 35/56 (62%), Gaps = 7/56 (12%)
 Query:     76 AGNHAQGVAFAAKKFGCKAVIVMPTVTPLIKVNRTKSYGAEVILHGDVYDDAYAYA 131
                GN  + VA+A +K G K  IV+PT  P   V + +  GA VI+HG+++DDA + A
 Sbjct:     85 GGNAGKSVAYAGRKLGIKTTIVLPTTIPEETVEKIRDEGANVIVHGNIWDDADSLA 140

>PDB3L707 (Closest domain: D8HM05_AMYMU 73-119) Number of domains in family: 12 Commentary (automatic): SUBNAME: SCAFFOLD BIOSYNTHESIS FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT REFERENCE FULL=PUTATIVE UNCHARACTERIZED BETA SUBUNIT CYSTEINE Length = 47 Score = 121 (51.2 bits), Expect = 6e-06 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Query:     71 LITASAGNHAQGVAFAAKKFGCKAVIVMPTVTPLIKVNRTKSYGAEV 117
               ++ ASAGNHAQGVA A+   G K+ + MP   PL K+  T+ YGA+V
 Sbjct:     73 VVAASAGNHAQGVALASSLLGAKSTVFMPLRAPLPKLAATRGYGADV 119

>PDD351N1 (Closest domain: F4Q8I7_DICFS 65-355) Number of domains in family: 2 Commentary (automatic): FULL=THREONINE SUBNAME: LYASE AMMONIA-LYASE Length = 291 Score = 110 (47.0 bits), Expect = 0.002 Identities = 55/223 (24%), Positives = 91/223 (40%), Gaps = 24/223 (10%)
 Query:      4 LEKFEEASELVKKVTNSTKLVYSDYLSEQSGGKVYLKPENMQHTGAYKIR-------GAY 56
               +E     S  V      T  ++ + LS+     V LK EN+Q  G   +R       G Y
 Sbjct:    127 IESVNRVSSYVSTYLKKTPQLHYELLSQLFKCNVQLKLENLQLFGDVYVRNCFSVLIGNY 186

 Query:     57 Y-KISTLSDEERGRGLITASAGNHA-------QGVAFAAKKFGCKAVI-VMP---TVTPL 104
               + ++ST+  E R  G   +              G+   A     K +I V P    +  +
 Sbjct:    187 FNQVSTIKKELREVGGYVSVMDPDKFDLQATFAGIVLTAIHLKMKFIIYVAPGKLNILQV 246

 Query:    105 IKVNRTKSYGAEVILHGDVYDDAYAYACELAEKEGYTFVH-PFNDIDVATGQGTIAMEIV 163
               +++    + GA++I H       Y  A + A      FV   FN      G GT+A E++
 Sbjct:    247 VQLYMCHARGAKIIFHKGDTQTCYQRAKQHANDLHMVFVDMKFNPQFSLIGAGTLASEMM 306

 Query:    164 QELPTVDYILVPIG----GGGLVSGVATLAKMLNPKIKVIGVE 202
               ++    D I++P+     G   VS ++   K+  PK+K I V+
 Sbjct:    307 EDCNDRDAIIIPLRMYSVGWSYVSAISLFYKIKQPKMKTIVVQ 349

>PDC650L5 (Closest domain: B9KPT4_RHOSK 71-103) Number of domains in family: 178 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC FULL=L-THREONINE BIOSYNTHESIS AMMONIA-LYASE ILVA Length = 33 Score = 108 (46.2 bits), Expect = 0.0003 Identities = 19/31 (61%), Positives = 22/31 (70%), Gaps = 16/31 (51%)
 Query:     69 RGLITASAGNHAQGVAFAAKKFGCKAVIVMP 99
               R  + ASAGNHAQGVA+A + FG K  I MP
 Sbjct:     71 RSFVCASAGNHAQGVAYACRHFGVKGTIFMP 101

>PDA346P1 (Closest domain: B8N1M7_ASPFN 39-138) Number of domains in family: 123 Commentary (automatic): BIOSYNTHESIS SUBNAME: SYNTHASE FULL=CYSTEINE TRANSFERASE EC=2.5.1.47 RECNAME: CYSTEINE AMINO-ACID FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT Length = 100 Score = 106 (45.4 bits), Expect = 0.001 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 1/61 (1%)
 Query:    130 YACELAEKEGYTFVHPFNDIDVATGQGTIAMEIVQELPTVDYILVPIGGGGLVSGVATLA 189
               +A E++  +GY F + F + D   G  TI  E+VQ++P +D     +G  G+V GVA + 
 Sbjct:     77 HAEEVSRSDGYYFTNQFKNRDALVGYETIGRELVQQVPEIDAFCGAVGTEGMVMGVARVP 136

 Query:    190 K 190
               K
 Sbjct:    137 K 137

>PD709608 (Closest domain: F9ZVU1_METMM 169-207) Number of domains in family: 143 Commentary (automatic): SUBNAME: BIOSYNTHESIS SYNTHASE FULL=CYSTEINE DEHYDRATASE TRANSFERASE RECNAME: CYSTEINE EC=2.5.1.47 AMINO-ACID Length = 39 Score = 104 (44.7 bits), Expect = 0.001 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 1/32 (3%)
 Query:    172 ILVPIGGGGLVSGVATLAKMLNPKIKVIGVEP 203
               I VP+GGGGLV+G+A   K + P+I++I VEP
 Sbjct:    172 IFVPVGGGGLVAGIAAYVKFVRPEIRIIAVEP 203

>PDC69598 (Closest domain: A6L731_BACV8 45-69) Number of domains in family: 61 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 FULL=PUTATIVE THREONINE UNCHARACTERIZED AMMONIA-LYASE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT Length = 25 Score = 102 (43.9 bits), Expect = 0.002 Identities = 18/25 (72%), Positives = 23/25 (92%), Gaps = 1/25 (4%)
 Query:     47 TGAYKIRGAYYKISTLSDEERGRGL 71
               TG++K+RGAYYKIS LSDEE+ RG+
 Sbjct:     45 TGSFKVRGAYYKISQLSDEEKARGV 69

>PD925716 (Closest domain: Q7VK29_HELHP 55-116) Number of domains in family: 3520 Commentary (automatic): BIOSYNTHESIS SYNTHASE FULL=CYSTEINE EC=2.5.1.47 TRANSFERASE RECNAME: CYSTEINE AMINO-ACID SUBNAME: LYASE Length = 62 Score = 101 (43.5 bits), Expect = 0.004 Identities = 20/48 (41%), Positives = 32/48 (66%), Gaps = 7/48 (14%)
 Query:     71 LITASAGNHAQGVAFAAKKFGCKAVIVMPTVTPLIKVNRTKSYGAEVI 118
               +I A+AGN   G+AF A+ FGCKA++++P    + K    ++ GA+VI
 Sbjct:     66 IIEATAGNTGLGIAFVAQHFGCKAILIVPDKFSIEKQILMRALGAQVI 113

>PDD9Q131 (Closest domain: Q8WW81_HUMAN 67-135) Number of domains in family: 1 Commentary (automatic): SUBNAME: REFERENCE FULL=SDS FULL=UNCHARACTERIZED Length = 69 Score = 101 (43.5 bits), Expect = 0.004 Identities = 20/59 (33%), Positives = 36/59 (61%), Gaps = 1/59 (1%)
 Query:     88 KKFGCKAVIVMPTVTPLIKVNRTKSYGAEVILHGDVYDDAYAYACELAEKE-GYTFVHP 145
               ++ G  A IV+P+ TP + + R K+ GA V + G++ D+A+  A  LA+   G+ ++ P
 Sbjct:     77 RQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPP 135

>PDA1P539 (Closest domain: Q1I705_PSEE4 136-195) Number of domains in family: 754 Commentary (automatic): SUBNAME: SYNTHASE FULL=THREONINE LYASE EC=4.2.3.1 FULL=L-THREONINE REFERENCE THREONINE FULL=PUTATIVE THRC Length = 60 Score = 101 (43.5 bits), Expect = 0.004 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 1/55 (1%)
 Query:     74 ASAGNHAQGVAFAAKKFGCKAVIVMPTVTPLIKVNRTKSYGAEVILHGDVYDDAY 128
               AS GN A  +A  + + G + VI +P  TP  K+ +   YGAEVIL    YD+A+
 Sbjct:    139 ASTGNAASALAGMSAERGLRNVIFIPRTTPREKLAQMIGYGAEVILVDGAYDEAF 193

>PDB003Y9 (Closest domain: A2BKW1_HYPBU 134-233) Number of domains in family: 141 Commentary (automatic): SUBNAME: SYNTHASE FULL=THREONINE LYASE EC=4.2.3.1 BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT THREONINE FULL=PUTATIVE Length = 100 Score = 101 (43.5 bits), Expect = 0.005 Identities = 30/96 (31%), Positives = 47/96 (48%), Gaps = 1/96 (1%)
 Query:     90 FGCKAVIVMPTVTPLIKVNRTKSYGAEVILHGDVYDDAYAYACELAEKEGYTFVHPFNDI 149
               +G +A I MP   P  K    ++ G EV+L     + A A   EL + + +   H ++  
 Sbjct:    134 YGLRARIYMPVNAPEGKKRLVRALGGEVVLTPSRGEAAQAVLWELKKPDVFYVAHTWSPF 193

 Query:    150 DVATGQGTIAMEIVQELPTVDYILVPIGGGGLVSGV 185
                V  G  TIA E  ++      +LVP+G GGL+ G+
 Sbjct:    194 YVE-GAKTIAFEAFEDGFRGSAVLVPVGSGGLLLGI 228

>PDB0H284 (Closest domain: D8J781_HALJB 149-236) Number of domains in family: 190 Commentary (automatic): SUBNAME: SYNTHASE FULL=CYSTEINE TRANSFERASE EC=2.5.1.47 A CYSTEINE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT FULL=PUTATIVE BETA Length = 88 Score = 99 (42.7 bits), Expect = 0.009 Identities = 26/74 (35%), Positives = 45/74 (60%), Gaps = 2/74 (2%)
 Query:    131 ACELAEKEGYTFVHPF-NDIDVATGQGTIAMEIVQELP-TVDYILVPIGGGGLVSGVATL 188
               A  +AEK G TF++ + N+++          E++++L   V +I+ P+G GG VSG+A  
 Sbjct:    151 AKRIAEKTGGTFLNQYENELNPQVHYEWTGEEVLEQLGGEVTHIVSPMGTGGTVSGIARR 210

 Query:    189 AKMLNPKIKVIGVE 202
                K   P+++VIGV+
 Sbjct:    211 VKEEYPEVRVIGVD 224

>PDB1O9V8 (Closest domain: B2JCU4_BURP8 146-204) Number of domains in family: 22 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE REFERENCE FULL=PUTATIVE UNCHARACTERIZED SHOTGUN LYASE GENOME SEQUENCE Length = 59 Score = 99 (42.7 bits), Expect = 0.008 Identities = 32/59 (54%), Positives = 41/59 (69%), Gaps = 1/59 (1%)
 Query:    142 FVHPFNDIDVATGQGTIAMEIV-QELPTVDYILVPIGGGGLVSGVATLAKMLNPKIKVI 199
               FVHPF+D  V  GQGT+AME++ Q    +  I VPIGGGGL +G+A   K + P+IKVI
 Sbjct:    146 FVHPFDDPYVIAGQGTVAMEVLSQHQAPIHAIFVPIGGGGLAAGIAAYVKSVRPEIKVI 204

>PDC422M4 (Closest domain: E8U0E2_ALIDB 159-209) Number of domains in family: 20 Commentary (automatic): SUBNAME: DEHYDRATASE LYASE EC=4.3.1.19 AMMONIA-LYASE FULL=THREONINE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT ALTNAME: BETA SUBUNIT Length = 51 Score = 99 (42.7 bits), Expect = 0.006 Identities = 27/49 (55%), Positives = 38/49 (77%), Gaps = 1/49 (2%)
 Query:    154 GQGTIAMEIVQELPTVDYILVPIGGGGLVSGVATLAKMLNPKIKVIGVE 202
               GQGT+A E+ +E+P +DY+ VP+GGGGL+SG    A+ L P+ +VIGVE
 Sbjct:    161 GQGTVAKELFEEVPHLDYLFVPLGGGGLLSGSLLAAQRLAPQCRVIGVE 209

>PDB021T5 (Closest domain: Q03MP7_STRTD 176-207) Number of domains in family: 194 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC BIOSYNTHESIS FULL=L-THREONINE AMMONIA-LYASE ILVA Length = 32 Score = 97 (42.0 bits), Expect = 0.009 Identities = 20/31 (64%), Positives = 25/31 (80%), Gaps = 2/31 (6%)
 Query:    170 DYILVPIGGGGLVSGVATLAKMLNPKIKVIG 200
               D ILVP+GGGGL+SGVAT  K + P I+V+G
 Sbjct:    177 DSILVPVGGGGLISGVATYIKDVAPSIEVVG 207