Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PDA2K6B3 score=275 PD003345 score=362 PDA8A4M1 score=172 PDA8V253 score=191 PDC5T1X9 score=308 PD011477 score=577 PDA1G0H9 score=481 PDC640W8 score=252 PDC6C9L2 score=195


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PD011477
PDA1G0H9
PD003345
PDC5T1X9
PDB028T7
PDA2K6B3
PDC640W8
PDB6Q6E9
PDC6C9L2
PDA8V253
PDA8A4M1
PDA252E8
PDA1E973
PDD143X2
PDC640C3
PDC899X9
PDC64434
PD460692
PDB4U1G9
PD110268
PDC0V617
PDB6Q4Z7
PDB6G8L5
PDC637R8
PDA0Y624
PDC5G2R9
PDA1X9N3
PD872729
PD126366
PDB2S0B6
PDB0C9Z0

Domain 3D modelling using Swiss-Model

Domain IDBEGINEND 
PD011477
PDA1G0H9
PD003345
PDC5T1X9
PDA2K6B3
PDC640W8
PDB6Q6E9
PDA8V253
PDA8A4M1
PDC640C3
PDC64434
PDC637R8

Domain 3D modelling using Geno3D

Domain IDBEGINEND 
PD011477
PDA1G0H9
PD003345
PDC5T1X9
PDA2K6B3
PDC640W8
PDB6Q6E9
PDA8V253
PDA8A4M1
PDC640C3
PDC64434
PDC637R8


HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(369 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

      6-60  #PDA2K6B3                                            275 2e-27
     10-79  #PDA0Y624                                            110 0.0003
     10-83  #PDC5G2R9                                            109 0.0004
     15-85  #PD003345                                            362 1e-39
     18-84  #PDA252E8                                            170 2e-12
     24-80  #PD110268                                            128 7e-07
     25-76  #PDB0C9Z0                                             99 0.006
     28-99  #PDB6G8L5                                            120 1e-05
    61-131  #PD872729                                            107 0.0008
    66-102  #PDA8A4M1                                            172 5e-13
     67-92  #PDC64434                                            132 2e-07
    73-122  #PDB2S0B6                                            101 0.003
    81-126  #PDB6Q4Z7                                            123 3e-06
    84-121  #PDB4U1G9                                            129 4e-07
    84-145  #PDD143X2                                            152 5e-10
    87-142  #PDC0V617                                            125 2e-06
    89-168  #PDA1E973                                            164 1e-11
    91-126  #PDC899X9                                            133 1e-07
    91-139  #PD460692                                            130 4e-07
    92-113  #PDC637R8                                            119 8e-06
    97-155  #PDA8V253                                            191 2e-15
   113-137  #PDC640C3                                            134 7e-08
   127-194  #PDC5T1X9                                            308 7e-32
   157-266  #PD011477                                            577 5e-71
   178-270  #PD126366                                            102 0.003
   185-255  #PDB028T7                                            295 5e-30
   201-275  #PDA1X9N3                                            108 0.0005
   263-364  #PDA1G0H9                                            481 1e-56
   267-310  #PDB6Q6E9                                            233 1e-21
   313-367  #PDC6C9L2                                            195 3e-16
   319-366  #PDC640W8                                            252 3e-24


>PD011477 (Closest domain: Q32AS7_SHIDS 157-266)
Number of domains in family: 2204
Commentary (automatic):
SUBNAME: RECEPTOR LIGAND-BINDING PRECURSOR FLAGS: AMINO SIGNAL FULL=EXTRACELLULAR ABC ACID  
Length = 110
Score = 577  (226.9 bits), Expect = 5e-71
Identities = 110/110 (100%), Positives = 110/110 (100%)

 Query:    157 ETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKEN 216
               ETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKEN
 Sbjct:    157 ETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKEN 216

 Query:    217 IDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEG 266
               IDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEG
 Sbjct:    217 IDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEG 266

>PDA1G0H9 (Closest domain: A9MTY6_SALPB 242-343) Number of domains in family: 806 Commentary (automatic): SUBNAME: RECEPTOR LIGAND-BINDING PRECURSOR FLAGS: FULL=EXTRACELLULAR SIGNAL AMINO ABC ACID Length = 102 Score = 481 (189.9 bits), Expect = 1e-56 Identities = 89/102 (87%), Positives = 95/102 (93%)
 Query:    263 AAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEP 322
               AAEGMLVTMPKRYDQDPAN+ IV+ALKADKKDPSGPYVWITYAAVQSLATA+ R+ S  P
 Sbjct:    242 AAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHAP 301

 Query:    323 LALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGS 364
               L LVKDLKANGA+TVIGPL WDEKGDLKGF+FGVFQWHADGS
 Sbjct:    302 LDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGS 343

>PD003345 (Closest domain: Q3YW70_SHISS 15-85) Number of domains in family: 2047 Commentary (automatic): SUBNAME: RECEPTOR SIGNAL PRECURSOR FLAGS: AMINO ABC LIGAND-BINDING FULL=EXTRACELLULAR ACID Length = 71 Score = 362 (144.1 bits), Expect = 1e-39 Identities = 71/71 (100%), Positives = 71/71 (100%)
 Query:     15 LAISHTAMADDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDD 74
               LAISHTAMADDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDD
 Sbjct:     15 LAISHTAMADDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDD 74

 Query:     75 ACDPKQAVAVA 85
               ACDPKQAVAVA
 Sbjct:     75 ACDPKQAVAVA 85

>PDC5T1X9 (Closest domain: H0Q7J3_ECOLI 126-194) Number of domains in family: 286 Commentary (automatic): SUBNAME: RECEPTOR LIGAND-BINDING FULL=EXTRACELLULAR PRECURSOR FLAGS: SIGNAL AMINO ACID ABC Length = 69 Score = 308 (123.2 bits), Expect = 7e-32 Identities = 58/68 (85%), Positives = 61/68 (89%), Gaps = 2/68 (2%)
 Query:    127 PELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLK 186
               PELT RGYQ I+RT GLDS QGPTAAKYILE VKPQRIAI+HDKQQYGEGLAR+VQDGLK
 Sbjct:    127 PELTARGYQLILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQYGEGLARAVQDGLK 186

 Query:    187 AANANVVF 194
                 NANVVF
 Sbjct:    187 KGNANVVF 194

>PDB028T7 (Closest domain: C7BLV5_PHOAA 186-256) Number of domains in family: 105 Commentary (automatic): SUBNAME: PRECURSOR FLAGS: FULL=PUTATIVE SIGNAL UNCHARACTERIZED RECEPTOR TRANSMEMBRANE LIGAND-BINDING LIPOPROTEIN Length = 71 Score = 295 (118.2 bits), Expect = 5e-30 Identities = 51/71 (71%), Positives = 62/71 (87%), Gaps = 2/71 (2%)
 Query:    185 LKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQ 244
               LK A  N+V F+G+T G+KDFSAL+ARLKKEN+DFVY+GGYYPEMGQ+LRQA+  GL  +
 Sbjct:    186 LKKAGVNIVLFEGVTVGDKDFSALVARLKKENVDFVYFGGYYPEMGQILRQAKQAGLNIR 245

 Query:    245 FMGPEGVGNAS 255
               FMGPEGVGN+S
 Sbjct:    246 FMGPEGVGNSS 256

>PDA2K6B3 (Closest domain: F4W0Z0_ECOLX 6-60) Number of domains in family: 485 Commentary (automatic): SUBNAME: RECEPTOR FLAGS: PRECURSOR SIGNAL AMINO LIGAND-BINDING FULL=EXTRACELLULAR ABC ACID Length = 55 Score = 275 (110.5 bits), Expect = 2e-27 Identities = 55/55 (100%), Positives = 55/55 (100%), Gaps = 2/55 (3%)
 Query:      6 KTIIAGMIALAISHTAMADDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKG 60
               KTIIAGMIALAISHTAMADDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKG
 Sbjct:      6 KTIIAGMIALAISHTAMADDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKG 60

>PDC640W8 (Closest domain: F0JUS4_ESCFE 337-384) Number of domains in family: 357 Commentary (automatic): SUBNAME: AMINO RECEPTOR ABC ACID FLAGS: PRECURSOR TRANSPORTER SIGNAL PERIPLASMIC Length = 48 Score = 252 (101.7 bits), Expect = 3e-24 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 2/48 (4%)
 Query:    319 SDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSST 366
               SDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSST
 Sbjct:    337 SDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSST 384

>PDB6Q6E9 (Closest domain: LIVK_ECOLI 267-310) Number of domains in family: 372 Commentary (automatic): SUBNAME: AMINO RECEPTOR ABC ACID FLAGS: PRECURSOR PERIPLASMIC SIGNAL BRANCHED-CHAIN Length = 44 Score = 233 (94.4 bits), Expect = 1e-21 Identities = 44/44 (100%), Positives = 44/44 (100%), Gaps = 2/44 (4%)
 Query:    267 MLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSL 310
               MLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSL
 Sbjct:    267 MLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSL 310

>PDC6C9L2 (Closest domain: Q7N006_PHOLL 313-369) Number of domains in family: 43 Commentary (automatic): SUBNAME: RECEPTOR AMINO LIGAND-BINDING FULL=EXTRACELLULAR BRANCHED-CHAIN ABC ACID TRANSPORTER PERIPLASMIC Length = 57 Score = 195 (79.7 bits), Expect = 3e-16 Identities = 36/55 (65%), Positives = 46/55 (83%), Gaps = 1/55 (1%)
 Query:    313 ALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTA 367
               A+ RTGS EP  LV+DLKAN  +TV+G L+W+  GDLKGF+FG+F+WHADGSST+
 Sbjct:    314 AMNRTGSMEPTDLVQDLKANPVDTVMGRLSWNAVGDLKGFEFGIFEWHADGSSTS 368

>PDA8V253 (Closest domain: B0RKF3_HERSE 2-61) Number of domains in family: 531 Commentary (automatic): SUBNAME: RECEPTOR PRECURSOR FLAGS: SIGNAL AMINO ABC LIGAND-BINDING FULL=EXTRACELLULAR SUBSTRATE-BINDING Length = 60 Score = 191 (78.2 bits), Expect = 2e-15 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 1/60 (1%)
 Query:     97 IGHLCSSSTQPASDIYEDEGILMISPGATNPELTQ-RGYQHIMRTAGLDSSQGPTAAKYI 155
               IGH+CS ST PASDIYE+EG++MI+P AT P+LT+ + ++ I RT G D  QGP AA+Y+
 Sbjct:      2 IGHVCSGSTIPASDIYENEGVVMITPSATAPQLTEAKPHKFIFRTIGRDDQQGPAAARYV 61

>PDA8A4M1 (Closest domain: E1RSP5_ECOUM 66-102) Number of domains in family: 66 Commentary (automatic): RECEPTOR SUBNAME: LIGAND-BINDING FULL=EXTRACELLULAR PRECURSOR FLAGS: SIGNAL AMINO ACID ABC Length = 37 Score = 172 (70.9 bits), Expect = 5e-13 Identities = 33/37 (89%), Positives = 35/37 (94%), Gaps = 1/37 (2%)
 Query:     66 KLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCS 102
               KL  V+YDDACDPKQAVAVANK+VNDGIKYVIGHLCS
 Sbjct:     66 KLQIVKYDDACDPKQAVAVANKVVNDGIKYVIGHLCS 102

>PDA252E8 (Closest domain: B1K7M5_BURCC 20-86) Number of domains in family: 432 Commentary (automatic): SUBNAME: RECEPTOR SIGNAL PRECURSOR FLAGS: LIGAND-BINDING FULL=EXTRACELLULAR FULL=PUTATIVE ABC TRANSPORTER Length = 67 Score = 170 (70.1 bits), Expect = 2e-12 Identities = 36/67 (53%), Positives = 46/67 (68%), Gaps = 4/67 (5%)
 Query:     18 SHTAMADDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACD 77
               +  A A+ +K+A+ G MSG +AQ+GDM   GA  AI+ INA GG  G+K   V  DDAC+
 Sbjct:     20 AAAAQAETVKIAIAGPMSGSVAQYGDMVKAGALTAIEQINAAGGAGGNKFEVVMMDDACE 79

 Query:     78 PKQAVAV 84
               PKQAVAV
 Sbjct:     80 PKQAVAV 86

>PDA1E973 (Closest domain: F2NLE2_MARHT 82-163) Number of domains in family: 649 Commentary (automatic): SUBNAME: RECEPTOR AMINO LIGAND-BINDING FULL=EXTRACELLULAR PRECURSOR FLAGS: SIGNAL ABC ACID Length = 82 Score = 164 (67.8 bits), Expect = 1e-11 Identities = 35/80 (43%), Positives = 51/80 (63%), Gaps = 1/80 (1%)
 Query:     89 VNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGLDSSQG 148
               VN+G+  V+G + SS + PA+++ +D GI+MIS  +TNP+ TQ G   I R A  D  QG
 Sbjct:     82 VNEGVVAVLGAISSSMSIPAAEVLQDAGIIMISTSSTNPQTTQIG-DFIFRMAYTDDFQG 140

 Query:    149 PTAAKYILETVKPQRIAIIH 168
                 AA+Y ++ +  QRIAI  
 Sbjct:    141 VVAARYAVQDLGAQRIAIFR 160

>PDD143X2 (Closest domain: F2LAM0_BURGS 86-149) Number of domains in family: 2 Commentary (automatic): SUBNAME: RECEPTOR LIGAND-BINDING FULL=PUTATIVE UNCHARACTERIZED FULL=EXTRACELLULAR Length = 64 Score = 152 (63.2 bits), Expect = 5e-10 Identities = 29/62 (46%), Positives = 40/62 (64%), Gaps = 1/62 (1%)
 Query:     84 VANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGL 143
               VA K+V+D +  V+GH+ S ST PAS IY D GI+ +SP ATNP  T++G+    R    
 Sbjct:     88 VAQKLVDDKVVAVVGHMQSGSTIPASRIYHDAGIVQVSPSATNPAYTRQGFATAYRVVAT 147

 Query:    144 DS 145
               D+
 Sbjct:    148 DA 149

>PDC640C3 (Closest domain: H0Q7J1_ECOLI 113-137) Number of domains in family: 380 Commentary (automatic): SUBNAME: AMINO RECEPTOR ABC ACID FLAGS: PRECURSOR SIGNAL TRANSPORTER PERIPLASMIC Length = 25 Score = 134 (56.2 bits), Expect = 7e-08 Identities = 25/25 (100%), Positives = 25/25 (100%), Gaps = 7/25 (28%)
 Query:    113 EDEGILMISPGATNPELTQRGYQHI 137
               EDEGILMISPGATNPELTQRGYQHI
 Sbjct:    113 EDEGILMISPGATNPELTQRGYQHI 137

>PDC899X9 (Closest domain: G2SAJ5_ENTAL 90-129) Number of domains in family: 5 Commentary (automatic): SUBNAME: RECEPTOR AMINO LIGAND-BINDING FULL=EXTRACELLULAR ACID FULL=BRANCHED-CHAIN PRECURSOR COMPONENT PERIPLASMIC Length = 40 Score = 133 (55.8 bits), Expect = 1e-07 Identities = 23/36 (63%), Positives = 29/36 (80%), Gaps = 1/36 (2%)
 Query:     91 DGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATN 126
               D +K VIGH CSSST PAS++Y D GI+ I+PG+TN
 Sbjct:     94 DKVKAVIGHFCSSSTMPASEVYSDAGIIAITPGSTN 129

>PDC64434 (Closest domain: G4PU79_ECOLX 67-92) Number of domains in family: 262 Commentary (automatic): SUBNAME: RECEPTOR AMINO ACID ABC FLAGS: PRECURSOR SIGNAL PERIPLASMIC LIGAND-BINDING Length = 26 Score = 132 (55.5 bits), Expect = 2e-07 Identities = 26/26 (100%), Positives = 26/26 (100%), Gaps = 2/26 (7%)
 Query:     67 LVGVEYDDACDPKQAVAVANKIVNDG 92
               LVGVEYDDACDPKQAVAVANKIVNDG
 Sbjct:     67 LVGVEYDDACDPKQAVAVANKIVNDG 92

>PD460692 (Closest domain: Q985D9_RHILO 116-171) Number of domains in family: 4 Commentary (automatic): SUBNAME: PRECURSOR FULL=PUTATIVE UNCHARACTERIZED FLAGS: SIGNAL FULL=ABC TRANSPORTER FULL=MLR5228 BINDING Length = 56 Score = 130 (54.7 bits), Expect = 4e-07 Identities = 24/53 (45%), Positives = 36/53 (67%), Gaps = 4/53 (7%)
 Query:     91 DGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELT----QRGYQHIMR 139
               +G+K++ GH CS S+ PAS +Y + G LM+SP ++NP LT    + G+  IMR
 Sbjct:    117 NGVKFIDGHACSGSSIPASAVYAEAGALMMSPASSNPVLTDAAAKAGWPTIMR 169

>PDB4U1G9 (Closest domain: F4GTE0_PUSST 88-125) Number of domains in family: 12 Commentary (automatic): SUBNAME: RECEPTOR KINASE LIGAND-BINDING FULL=EXTRACELLULAR FULL=SERINE/THREONINE AMINO SUBSTRATE-BINDING BRANCHED-CHAIN ACID Length = 38 Score = 129 (54.3 bits), Expect = 4e-07 Identities = 21/38 (55%), Positives = 32/38 (84%), Gaps = 4/38 (10%)
 Query:     84 VANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMIS 121
               VAN++VND I YV+GH+CS +T  A+DIY +EG++M++
 Sbjct:     88 VANRVVNDEIHYVVGHVCSGATIAATDIYNNEGVVMVT 125

>PD110268 (Closest domain: F4GTE0_PUSST 28-85) Number of domains in family: 203 Commentary (automatic): SUBNAME: RECEPTOR FULL=PUTATIVE AMINO ACID UNCHARACTERIZED SIGNAL PRECURSOR FLAGS: LIGAND-BINDING Length = 58 Score = 128 (53.9 bits), Expect = 7e-07 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 1/57 (1%)
 Query:     24 DDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQ 80
               D IK+A+ G  +G + Q+G M   G   A++ INA GG+ G ++  V  DD C+PKQ
 Sbjct:     28 DTIKIAIAGPFTGALTQYGTMVKEGVDTAVEQINAAGGVLGKQIEAVTVDDGCEPKQ 84

>PDC0V617 (Closest domain: A1WGR4_VEREI 94-149) Number of domains in family: 16 Commentary (automatic): RECEPTOR SUBNAME: LIGAND-BINDING FULL=EXTRACELLULAR PRECURSOR FLAGS: SIGNAL COMPONENT AMINO PERIPLASMIC Length = 56 Score = 125 (52.8 bits), Expect = 2e-06 Identities = 27/57 (47%), Positives = 40/57 (70%), Gaps = 2/57 (3%)
 Query:     87 KIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMR-TAG 142
               K+++ GI+YV+G  CS    PAS +Y  EG  M+S  ATNP++T+ GY+++ R TAG
 Sbjct:     94 KLIDSGIQYVMGPYCSGVAIPASRVY-SEGGAMLSTVATNPKVTESGYKNLFRITAG 149

>PDB6Q4Z7 (Closest domain: Q39LD0_BURS3 93-138) Number of domains in family: 25 Commentary (automatic): SUBNAME: COMPONENT RECEPTOR AMINO FULL=PUTATIVE ABC PERIPLASMIC TRANSPORTER ACID BRANCHED-CHAIN Length = 46 Score = 123 (52.0 bits), Expect = 3e-06 Identities = 26/46 (56%), Positives = 32/46 (69%), Gaps = 1/46 (2%)
 Query:     81 AVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATN 126
               A  VA K+V+D +  VIGHL S ++ PAS IY D GI+ ISP ATN
 Sbjct:     93 ATQVAQKLVDDKVVAVIGHLNSGTSIPASKIYSDAGIVQISPSATN 138

>PDB6G8L5 (Closest domain: A1SHR8_NOCSJ 39-117) Number of domains in family: 17 Commentary (automatic): KINASE SUBNAME: SERINE/THREONINE-PROTEIN NUCLEOTIDE-BINDING ATP-BINDING FULL=PUTATIVE SERINE/THREONINE PRECURSOR FLAGS: RECEPTOR Length = 79 Score = 120 (50.8 bits), Expect = 1e-05 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 6/78 (7%)
 Query:     28 VAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGI-----KGDKLVGVEYDDACDPKQAV 82
               VAV G M+G    +G  + +G + A K+IN  GGI     KG K+  V++DD  DP Q  
 Sbjct:     40 VAVAGPMTGDNGIYGQDQLSGVQFAAKEINDSGGIPDGPLKGKKIKVVKFDDVADPNQGA 99

 Query:     83 AVANKIVND-GIKYVIGH 99
               +VA KI +D  I  V GH
 Sbjct:    100 SVAQKICDDTSIMAVFGH 117

>PDC637R8 (Closest domain: H0Q7J3_ECOLI 92-113) Number of domains in family: 605 Commentary (automatic): SUBNAME: RECEPTOR AMINO ABC ACID FLAGS: PRECURSOR SIGNAL LIGAND-BINDING FULL=EXTRACELLULAR Length = 22 Score = 119 (50.4 bits), Expect = 8e-06 Identities = 22/22 (100%), Positives = 22/22 (100%), Gaps = 2/22 (9%)
 Query:     92 GIKYVIGHLCSSSTQPASDIYE 113
               GIKYVIGHLCSSSTQPASDIYE
 Sbjct:     92 GIKYVIGHLCSSSTQPASDIYE 113

>PDA0Y624 (Closest domain: A6SVQ8_JANMA 5-85) Number of domains in family: 390 Commentary (automatic): SUBNAME: RECEPTOR SIGNAL PRECURSOR FLAGS: LIGAND-BINDING FULL=EXTRACELLULAR ABC AMINO SUBSTRATE-BINDING Length = 81 Score = 110 (47.0 bits), Expect = 0.0003 Identities = 30/73 (41%), Positives = 43/73 (58%), Gaps = 3/73 (4%)
 Query:     10 AGMIALAISHTAMADDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVG 69
               A ++ALA S  A    +K+  VG ++G  A  G    NGAR A++++NAKG +   K V 
 Sbjct:     13 AVLLALAGSTLAQEQIVKIGHVGPVTGTDAHMGKDNENGARLAVEELNAKGVVINGKKVK 72

 Query:     70 VEY---DDACDPK 79
               ++Y   DDA DPK
 Sbjct:     73 LQYMPEDDAADPK 85

>PDC5G2R9 (Closest domain: A8ZZ39_DESOH 18-90) Number of domains in family: 74 Commentary (automatic): SUBNAME: FULL=PUTATIVE PRECURSOR FLAGS: SIGNAL AMINO UNCHARACTERIZED ACID ABC RECEPTOR Length = 73 Score = 109 (46.6 bits), Expect = 0.0004 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 5/74 (6%)
 Query:     10 AGMIALAISHTAMADDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVG 69
               AGM  + ++ T    +I +   G  +GP A WG +   G     K INA+GGI G KLV 
 Sbjct:     21 AGMCEVGVTDT----EIHIGQWGPQTGPAAPWGAVA-RGTDAYFKMINAEGGIHGRKLVH 75

 Query:     70 VEYDDACDPKQAVA 83
                 +DDA +P + VA
 Sbjct:     76 HYFDDAYNPAKTVA 89

>PDA1X9N3 (Closest domain: C4ZIP7_THASP 204-282) Number of domains in family: 131 Commentary (automatic): SUBNAME: FULL=PUTATIVE FLAGS: PRECURSOR AMINO SIGNAL UNCHARACTERIZED ACID ABC SUBSTRATE-BINDING Length = 79 Score = 108 (46.2 bits), Expect = 0.0005 Identities = 28/76 (36%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
 Query:    201 GEKDFSALIARLKKENIDFVYYGGY-YPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNI 259
               G  D S  IA+L++   DF  + GY    + + + QAR +GL TQFMG     + S    
 Sbjct:    207 GAVDVSTEIAKLRRARPDFTIFHGYILGPIPEFIGQARQMGLDTQFMGTFWTMDNSTVMQ 266

 Query:    260 AGDAAEGMLVTMPKRY 275
                G+ AEG +  MP  Y
 Sbjct:    267 MGELAEGFMGVMPYNY 282

>PD872729 (Closest domain: C7QPF7_CYAP0 448-545) Number of domains in family: 682 Commentary (automatic): SUBNAME: ABC TRANSPORTER SIGNAL FLAGS: PRECURSOR FULL=PUTATIVE BINDING SUBSTRATE-BINDING AMINO Length = 98 Score = 107 (45.8 bits), Expect = 0.0008 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 1/72 (1%)
 Query:     61 GIKGDKLVGVEYDDACDPKQAVAVANKIVNDG-IKYVIGHLCSSSTQPASDIYEDEGILM 119
               GI G  L  V  DD  D  +A  +A K+ N G +  V+GH  S ST+    IYE   +L+
 Sbjct:    450 GINGHGLRVVISDDFNDTGRAKNIAEKLSNQGQVLGVVGHYTSDSTRSVLPIYEMNNLLL 509

 Query:    120 ISPGATNPELTQ 131
               ISP +T   LT+
 Sbjct:    510 ISPTSTAESLTE 521

>PD126366 (Closest domain: B5Y600_COPPD 323-428) Number of domains in family: 565 Commentary (automatic): SUBNAME: RECEPTOR AMINO SIGNAL FLAGS: PRECURSOR ABC ACID TRANSPORTER PERIPLASMIC Length = 106 Score = 102 (43.9 bits), Expect = 0.003 Identities = 27/95 (28%), Positives = 50/95 (52%), Gaps = 4/95 (4%)
 Query:    178 ARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENID--FVYYGGYYPEMGQMLRQ 235
               A+ VQ+G+K    ++V+       E DF++ + R+K    +  F+Y           ++ 
 Sbjct:    333 AQGVQEGVKKYGGSLVYSSSFPGTETDFTSYLTRIKNSGAEVIFLYAPANTSAGANAVKT 392

 Query:    236 ARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVT 270
               A+S+GL  + + P     A ++ +AGDAAEG+ +T
 Sbjct:    393 AKSLGLTQKIILPYSY--AGITAMAGDAAEGVYIT 425

>PDB2S0B6 (Closest domain: D3VH51_XENNA 33-88) Number of domains in family: 9 Commentary (automatic): SUBNAME: FULL=PUTATIVE UNCHARACTERIZED API70 FULL=UNCHARACTERIZED Length = 56 Score = 101 (43.5 bits), Expect = 0.003 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Query:     73 DDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISP 122
               DDA +P+QA  VA   ++ G++ VIGH  S   + A  +Y+  GI ++ P
 Sbjct:     39 DDAANPEQACIVAQAFIDSGVQAVIGHFNSECARVAGRLYQSAGIPLLLP 88

>PDB0C9Z0 (Closest domain: F2J1T7_POLGS 19-78) Number of domains in family: 22 Commentary (automatic): SUBNAME: AMINO ACID SUBSTRATE-BINDING RECEPTOR FULL=BRANCHED-CHAIN LIGAND-BINDING SYSTEM PERIPLASMIC ABC Length = 60 Score = 99 (42.7 bits), Expect = 0.006 Identities = 22/53 (41%), Positives = 33/53 (62%), Gaps = 1/53 (1%)
 Query:     25 DIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIK-GDKLVGVEYDDAC 76
               D+K+ ++G +SGPIA       + A+ AI  +N +GG+  G+KLV V  D AC
 Sbjct:     26 DVKIGLLGGISGPIAAMAPAMIDAAQLAISQVNEQGGLMGGEKLVAVIGDSAC 78