Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PDC8I2M3 score=122 PD445685 score=178


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PD445685
PDC8I2M3
PDC6N5H1



HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(70 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

      1-26  #PDC8I2M3                                            122 5e-08
      1-24  #PDC6N5H1                                            114 9e-07
     26-59  #PD445685                                            178 4e-16


>PD445685 (Closest domain: D2FF68_STAAU 26-62)
Number of domains in family: 42
Commentary (automatic):
SUBNAME: FULL=PUTATIVE UNCHARACTERIZED ISLAND FULL=PATHOGENICITY FULL=HYPOTHETICAL SAPI ELEMENT-ASSOCIATED MOBILE PATHOGENICITY  
Length = 37
Score = 178  (73.2 bits), Expect = 4e-16
Identities = 34/34 (100%), Positives = 34/34 (100%)

 Query:     26 VYIHEFKCGEKERTETVNREQHLQAIIEWTLQQI 59
               VYIHEFKCGEKERTETVNREQHLQAIIEWTLQQI
 Sbjct:     26 VYIHEFKCGEKERTETVNREQHLQAIIEWTLQQI 59

>PDC8I2M3 (Closest domain: Q2YUE3_STAAB 1-26) Number of domains in family: 4 Commentary (automatic): SUBNAME: FULL=HYPOTHETICAL ELEMENT-ASSOCIATED MOBILE FULL=SIMILARITY Length = 26 Score = 122 (51.6 bits), Expect = 5e-08 Identities = 26/26 (100%), Positives = 26/26 (100%)
 Query:      1 MNNEQKEVIKDIYSSLESVANNKSEV 26
               MNNEQKEVIKDIYSSLESVANNKSEV
 Sbjct:      1 MNNEQKEVIKDIYSSLESVANNKSEV 26

>PDC6N5H1 (Closest domain: D2FF68_STAAU 1-24) Number of domains in family: 21 Commentary (automatic): SUBNAME: FULL=PUTATIVE UNCHARACTERIZED ISLAND FULL=PATHOGENICITY FULL=CONSERVED FULL=PHAGE PHAGE SAPI MW0749 Length = 24 Score = 114 (48.5 bits), Expect = 9e-07 Identities = 24/24 (100%), Positives = 24/24 (100%)
 Query:      1 MNNEQKEVIKDIYSSLESVANNKS 24
               MNNEQKEVIKDIYSSLESVANNKS
 Sbjct:      1 MNNEQKEVIKDIYSSLESVANNKS 24