Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PDB3R8O2 score=88 PDC681P2 score=148 PDB3R8O2 score=88 PDC66169 score=131


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PDC681P2
PDC66169
PDB3R8O2



HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(112 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

     18-74  #PDB3R8O2                                             88 0.008
     34-64  #PDC681P2                                            148 3e-11
    78-104  #PDC66169                                            131 9e-09


>PDC681P2 (Closest domain: D2N5S5_STAA5 109-143)
Number of domains in family: 76
Commentary (automatic):
SUBNAME: FULL=PUTATIVE UNCHARACTERIZED MEMBRANE FULL=SNARE ASSOCIATED GOLGI FULL=CONSERVED PLASMID PROTEIN-RELATED  
Length = 35
Score = 148  (61.6 bits), Expect = 3e-11
Identities = 31/31 (100%), Positives = 31/31 (100%)

 Query:     34 TPNTLINFVASLSHIRPKYYFIVLASSKLVS 64
               TPNTLINFVASLSHIRPKYYFIVLASSKLVS
 Sbjct:    113 TPNTLINFVASLSHIRPKYYFIVLASSKLVS 143

>PDC66169 (Closest domain: F4FJ56_STAAU 157-183) Number of domains in family: 120 Commentary (automatic): SUBNAME: FULL=PUTATIVE UNCHARACTERIZED MEMBRANE FULL=SNARE ASSOCIATED GOLGI YHJE FULL=MEMBRANE REFERENCE Length = 27 Score = 131 (55.1 bits), Expect = 9e-09 Identities = 27/27 (100%), Positives = 27/27 (100%)
 Query:     78 ILTHPLRGILMLVVLVVFWIVGKKLEQ 104
               ILTHPLRGILMLVVLVVFWIVGKKLEQ
 Sbjct:    157 ILTHPLRGILMLVVLVVFWIVGKKLEQ 183

>PDB3R8O2 (Closest domain: B1HN88_LYSSC 101-157) Number of domains in family: 3 Commentary (automatic): SUBNAME: ASSOCIATED FULL=SNARE GOLGI FULL=HYPOTHETICAL YHJE Length = 57 Score = 88 (38.5 bits), Expect = 0.008 Identities = 19/57 (33%), Positives = 28/57 (49%)
 Query:     18 DRQGXXXXXXXXXXXXTPNTLINFVASLSHIRPKYYFIVLASSKLVSTIILGYLGKE 74
               D  G            TP+ ++N VA LSHI  K+Y +VL + K V  + +  LG +
 Sbjct:    101 DMNGISPLFVLLCFPFTPSVIVNIVAGLSHIHKKFYLVVLLAGKFVMILGMSVLGYD 157