Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PDD559H5 score=190 PD661970 score=184 PDC6A2Q5 score=265 PDB3F1O6 score=544 PDC6A828 score=157 PDC64090 score=224 PDD4V9Q6 score=113 PD460556 score=299 PDC6A126 score=639


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PDC6A126
PDB3F1O6
PDB5B3V4
PD460556
PDC6A2Q5
PDC64090
PDD559H5
PD661970
PDC6A828
PD628229
PD713314
PDD4V9Q6



HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(555 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

      1-28  #PD628229                                            137 7e-08
      1-39  #PDD559H5                                            190 8e-15
     41-76  #PD661970                                            184 4e-14
    80-132  #PDC6A2Q5                                            265 3e-25
   135-236  #PDB3F1O6                                            544 3e-64
   140-218  #PDB5B3V4                                            418 3e-46
   219-247  #PDC6A828                                            157 2e-10
   248-306  #PDC64090                                            224 3e-19
   286-330  #PDD4V9Q6                                            113 0.0001
   331-393  #PD460556                                            299 6e-30
   434-554  #PDC6A126                                            639 8e-78
   437-545  #PD713314                                            122 2e-05


>PDC6A126 (Closest domain: Q5HD43_STAAC 509-629)
Number of domains in family: 57
Commentary (automatic):
SUBNAME: FULL=PUTATIVE UNCHARACTERIZED MEMBRANE PROTEIN FULL=MEMBRANE FULL=CONSERVED FULL=HYPOTHETICAL RESISTANCE FULL=FUSARIC  
Length = 121
Score = 639  (250.8 bits), Expect = 8e-78
Identities = 121/121 (100%), Positives = 121/121 (100%)

 Query:    434 VYQKNTAMNLSVKLNNMTQVYNAANGELFSDKTLIQNYYPSLFALEEISFMLNRAMANED 493
               VYQKNTAMNLSVKLNNMTQVYNAANGELFSDKTLIQNYYPSLFALEEISFMLNRAMANED
 Sbjct:    509 VYQKNTAMNLSVKLNNMTQVYNAANGELFSDKTLIQNYYPSLFALEEISFMLNRAMANED 568

 Query:    494 RLTINEQLMGEYLAIFENIAKHFELNTELEIKILPDLPQYNYIQSAMMNIQHNGFRERDK 553
               RLTINEQLMGEYLAIFENIAKHFELNTELEIKILPDLPQYNYIQSAMMNIQHNGFRERDK
 Sbjct:    569 RLTINEQLMGEYLAIFENIAKHFELNTELEIKILPDLPQYNYIQSAMMNIQHNGFRERDK 628

 Query:    554 N 554
               N
 Sbjct:    629 N 629

>PDB3F1O6 (Closest domain: Q2G2L4_STAA8 210-311) Number of domains in family: 14 Commentary (automatic): SUBNAME: FULL=PUTATIVE MEMBRANE UNCHARACTERIZED FULL=MEMBRANE INTEGRAL INNER PROTEIN TRANSMEMBRANE REFERENCE Length = 102 Score = 544 (214.2 bits), Expect = 3e-64 Identities = 102/102 (100%), Positives = 102/102 (100%)
 Query:    135 TSSNDKLSRRFQKLLLLHTSAQGIYSELLELNAKQIRPLPDELIEMMDHIIAQLDNSEEN 194
               TSSNDKLSRRFQKLLLLHTSAQGIYSELLELNAKQIRPLPDELIEMMDHIIAQLDNSEEN
 Sbjct:    210 TSSNDKLSRRFQKLLLLHTSAQGIYSELLELNAKQIRPLPDELIEMMDHIIAQLDNSEEN 269

 Query:    195 VRYWRKEVTVTEEFQNLFNHILKIDEMVHANEARIAYEADMR 236
               VRYWRKEVTVTEEFQNLFNHILKIDEMVHANEARIAYEADMR
 Sbjct:    270 VRYWRKEVTVTEEFQNLFNHILKIDEMVHANEARIAYEADMR 311

>PDB5B3V4 (Closest domain: Q2FDZ6_STAA3 215-293) Number of domains in family: 60 Commentary (automatic): SUBNAME: FULL=PUTATIVE UNCHARACTERIZED MEMBRANE PROTEIN FULL=METHYL-ACCEPTING SENSOR FULL=MEMBRANE CACHE CHEMOTAXIS Length = 79 Score = 418 (165.6 bits), Expect = 3e-46 Identities = 79/79 (100%), Positives = 79/79 (100%)
 Query:    140 KLSRRFQKLLLLHTSAQGIYSELLELNAKQIRPLPDELIEMMDHIIAQLDNSEENVRYWR 199
               KLSRRFQKLLLLHTSAQGIYSELLELNAKQIRPLPDELIEMMDHIIAQLDNSEENVRYWR
 Sbjct:    215 KLSRRFQKLLLLHTSAQGIYSELLELNAKQIRPLPDELIEMMDHIIAQLDNSEENVRYWR 274

 Query:    200 KEVTVTEEFQNLFNHILKI 218
               KEVTVTEEFQNLFNHILKI
 Sbjct:    275 KEVTVTEEFQNLFNHILKI 293

>PD460556 (Closest domain: F4FLB9_STAAU 383-445) Number of domains in family: 233 Commentary (automatic): SUBNAME: FULL=PUTATIVE UNCHARACTERIZED MEMBRANE INTEGRAL FULL=MEMBRANE FULL=INTEGRAL PROTEIN REFERENCE FULL=CONSERVED Length = 63 Score = 299 (119.8 bits), Expect = 6e-30 Identities = 63/63 (100%), Positives = 63/63 (100%)
 Query:    331 VILMGIAALFTEALVGANYAIAVVFITIQVILMNGLASQNLTINIAFPRVIDVAMGIVIA 390
               VILMGIAALFTEALVGANYAIAVVFITIQVILMNGLASQNLTINIAFPRVIDVAMGIVIA
 Sbjct:    383 VILMGIAALFTEALVGANYAIAVVFITIQVILMNGLASQNLTINIAFPRVIDVAMGIVIA 442

 Query:    391 IIG 393
               IIG
 Sbjct:    443 IIG 445

>PDC6A2Q5 (Closest domain: F4FLB9_STAAU 132-184) Number of domains in family: 56 Commentary (automatic): SUBNAME: FULL=PUTATIVE UNCHARACTERIZED MEMBRANE PROTEIN FULL=MEMBRANE FULL=CONSERVED FULL=HYPOTHETICAL RESISTANCE FULL=FUSARIC Length = 53 Score = 265 (106.7 bits), Expect = 3e-25 Identities = 53/53 (100%), Positives = 53/53 (100%)
 Query:     80 TIVFSKNKAEEQAIQNDFKLISKLLHTYNDKSAFLQVAKTAVDSFKASDKLLI 132
               TIVFSKNKAEEQAIQNDFKLISKLLHTYNDKSAFLQVAKTAVDSFKASDKLLI
 Sbjct:    132 TIVFSKNKAEEQAIQNDFKLISKLLHTYNDKSAFLQVAKTAVDSFKASDKLLI 184

>PDC64090 (Closest domain: D0K983_STAAD 300-372) Number of domains in family: 384 Commentary (automatic): SUBNAME: FULL=PUTATIVE UNCHARACTERIZED MEMBRANE FAMILY PROTEIN YCCS FULL=MEMBRANE FULL=INTEGRAL YCCS/YHFK Length = 73 Score = 224 (90.9 bits), Expect = 3e-19 Identities = 44/59 (74%), Positives = 44/59 (74%), Gaps = 1/59 (1%)
 Query:    248 LTLDSIVFRNTLRYTXXXXXXXXXXXXXXXEKAYWIPLSAHTILLGTSTIHAIERGMAR 306
               LTLDSIVFRNTLRYT               EKAYWIPLSAHTILLGTSTIHAIERGMAR
 Sbjct:    300 LTLDSIVFRNTLRYTAIMMIAIFIALMFDFEKAYWIPLSAHTILLGTSTIHAIERGMAR 358

>PDD559H5 (Closest domain: Q2G2L4_STAA8 49-114) Number of domains in family: 1 Commentary (automatic): SUBNAME: REFERENCE FULL=PUTATIVE UNCHARACTERIZED Length = 66 Score = 190 (77.8 bits), Expect = 8e-15 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 1/39 (2%)
 Query:      1 MMLGTLTAKTPLVFGMTLLIVTVIPFYIFTALKIAGPSS 39
               MMLGTLTAKTPLVFGMTLLIVTVIPFYIFTALKIAGPSS
 Sbjct:     76 MMLGTLTAKTPLVFGMTLLIVTVIPFYIFTALKIAGPSS 114

>PD661970 (Closest domain: D3ET58_STAA4 93-128) Number of domains in family: 76 Commentary (automatic): SUBNAME: FULL=PUTATIVE UNCHARACTERIZED MEMBRANE PROTEIN FULL=MEMBRANE INTEGRAL REFERENCE INNER TRANSMEMBRANE Length = 36 Score = 184 (75.5 bits), Expect = 4e-14 Identities = 36/36 (100%), Positives = 36/36 (100%), Gaps = 1/36 (2%)
 Query:     41 FFIVTFSLPINLPIAPEEALYRGFAILVGGILATMM 76
               FFIVTFSLPINLPIAPEEALYRGFAILVGGILATMM
 Sbjct:     93 FFIVTFSLPINLPIAPEEALYRGFAILVGGILATMM 128

>PDC6A828 (Closest domain: D8HFH6_STAAF 271-299) Number of domains in family: 53 Commentary (automatic): SUBNAME: FULL=PUTATIVE UNCHARACTERIZED MEMBRANE FULL=MEMBRANE PROTEIN FULL=HYPOTHETICAL RESISTANCE FULL=FUSARIC FAMILY Length = 29 Score = 157 (65.1 bits), Expect = 2e-10 Identities = 29/29 (100%), Positives = 29/29 (100%), Gaps = 1/29 (3%)
 Query:    219 DEMVHANEARIAYEADMRKPLYSKRIYQN 247
               DEMVHANEARIAYEADMRKPLYSKRIYQN
 Sbjct:    271 DEMVHANEARIAYEADMRKPLYSKRIYQN 299

>PD628229 (Closest domain: E5RBK4_STAAG 1-28) Number of domains in family: 56 Commentary (automatic): SUBNAME: FULL=PUTATIVE UNCHARACTERIZED MEMBRANE FULL=MEMBRANE PROTEIN FULL=HYPOTHETICAL FULL=CONSERVED RESISTANCE FULL=FUSARIC Length = 28 Score = 137 (57.4 bits), Expect = 7e-08 Identities = 28/28 (100%), Positives = 28/28 (100%), Gaps = 2/28 (7%)
 Query:      1 MMLGTLTAKTPLVFGMTLLIVTVIPFYI 28
               MMLGTLTAKTPLVFGMTLLIVTVIPFYI
 Sbjct:      1 MMLGTLTAKTPLVFGMTLLIVTVIPFYI 28

>PD713314 (Closest domain: Q0STF3_CLOPS 513-626) Number of domains in family: 41 Commentary (automatic): SUBNAME: MEMBRANE FULL=PUTATIVE FULL=INTEGRAL INTEGRAL UNCHARACTERIZED FULL=MEMBRANE REFERENCE INNER PROTEIN Length = 114 Score = 122 (51.6 bits), Expect = 2e-05 Identities = 28/109 (25%), Positives = 58/109 (53%), Gaps = 2/109 (1%)
 Query:    437 KNTAMNLSVKLNNMTQVYNAANGELFSDKTLIQNYYPSLFALEEISFMLNRAMANEDRLT 496
               KN    + V L N+   YN A GE+  ++ +++  +P  F+LE IS++L++    +  L 
 Sbjct:    516 KNMKEKMGVDLMNLKMAYNTALGEVPRNEEMLEMLWPVFFSLEHISYLLDKYCTTKKYLN 575

 Query:    497 INEQLMGEYLAIFENIAKHFELNTELEIKILPDLPQYNYIQSAMMNIQH 545
               +++  + + L + E IA   E   +++ K +P++ + + I     +IQ 
 Sbjct:    576 LSDDELAQLLLVLEKIAIFIEQGIDVKPKKVPNIKEISQICEEFNSIQR 624

>PDD4V9Q6 (Closest domain: Q2G2L5_STAA8 1-56) Number of domains in family: 1 Commentary (automatic): SUBNAME: REFERENCE FULL=PUTATIVE UNCHARACTERIZED Length = 56 Score = 113 (48.1 bits), Expect = 0.0001 Identities = 26/45 (57%), Positives = 26/45 (57%), Gaps = 2/45 (4%)
 Query:    286 SAHTILLGTSTIHAIERGMARXXXXXXXXXXXXXXXXXXXPTPVA 330
               SAHTILLGTSTIHAIERGMAR                   PTPVA
 Sbjct:     12 SAHTILLGTSTIHAIERGMARGLGTILGVLVLSVILLFSIPTPVA 56