Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PD526846 score=188 PD786156 score=252 PDB5H8I3 score=186 PDC7L8T4 score=164 PD482214 score=218 PDC7L8T4 score=164 PDA857M8 score=148 PDD08828 score=123 PD335273 score=104 PD879289 score=118 PD827414 score=121 PDA1F5E7 score=443 PDD081N0 score=116


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PDA1F5E7
PD786156
PD482214
PD526846
PDB5H8I3
PDC7L8T4
PDA026V7
PDB3L707
PD414066
PDA2K3G9
PDA1V4U2
PDA857M8
PDC653O7
PD387799
PDC650L5
PDD08828
PD827414
PDC677U8
PDA210O4
PD879289
PDD081N0
PDC66453
PD869428
PD335273
PDC69598
PDB4F142
PD925716

Domain 3D modelling using Swiss-Model

Domain IDBEGINEND 
PD786156
PDB5H8I3
PD414066
PDA2K3G9
PDA1V4U2
PD869428

Domain 3D modelling using Geno3D

Domain IDBEGINEND 
PD786156
PDB5H8I3
PD414066
PDA2K3G9
PDA1V4U2
PD869428


HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(458 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

    73-106  #PD526846                                            188 6e-15
    73-106  #PD869428                                            105 0.001
    91-117  #PDC653O7                                            147 2e-09
    91-152  #PD786156                                            252 8e-24
    99-123  #PDC69598                                            104 0.001
   113-261  #PDC7L8T4                                            164 1e-10
   118-165  #PDB5H8I3                                            186 1e-14
   120-152  #PDC650L5                                            130 5e-07
   121-213  #PDA2K3G9                                            150 2e-09
   123-175  #PDA1V4U2                                            148 3e-09
   123-170  #PD925716                                            100 0.006
   123-169  #PDA210O4                                            119 2e-05
   123-169  #PDB3L707                                            157 1e-10
   158-211  #PDC66453                                            108 0.0005
   158-270  #PDA857M8                                            148 6e-09
   168-214  #PDA026V7                                            162 3e-11
   171-213  #PD414066                                            152 5e-10
   194-242  #PDC677U8                                            120 1e-05
   204-292  #PD335273                                            104 0.004
   215-260  #PD482214                                            218 4e-19
   237-271  #PDD08828                                            123 5e-06
   281-303  #PD879289                                            118 2e-05
   347-370  #PD827414                                            121 8e-06
   368-454  #PDA1F5E7                                            443 2e-50
   372-457  #PDD081N0                                            116 0.0001
   383-450  #PD387799                                            147 4e-09
   406-447  #PDB4F142                                            103 0.002


>PDA1F5E7 (Closest domain: B0RH37_CLAMS 368-454)
Number of domains in family: 442
Commentary (automatic):
SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 AMMONIA-LYASE FULL=L-THREONINE REFERENCE FULL=PUTATIVE THREONINE  
Length = 87
Score = 443  (175.3 bits), Expect = 2e-50
Identities = 87/87 (100%), Positives = 87/87 (100%)

 Query:    368 RVISRGLAASDRYVKLRIMLPDRPGQLARTSQIISEANANVVEVLHTRHGRGLQISEVEL 427
               RVISRGLAASDRYVKLRIMLPDRPGQLARTSQIISEANANVVEVLHTRHGRGLQISEVEL
 Sbjct:    368 RVISRGLAASDRYVKLRIMLPDRPGQLARTSQIISEANANVVEVLHTRHGRGLQISEVEL 427

 Query:    428 EVSVETRGPEHTGEVVQRLRDAGYDPR 454
               EVSVETRGPEHTGEVVQRLRDAGYDPR
 Sbjct:    428 EVSVETRGPEHTGEVVQRLRDAGYDPR 454

>PD786156 (Closest domain: F8A7C5_CELGA 38-102) Number of domains in family: 1947 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC DEHYDRATASE AMMONIA-LYASE THREONINE FULL=L-THREONINE Length = 65 Score = 252 (101.7 bits), Expect = 8e-24 Identities = 49/62 (79%), Positives = 54/62 (87%)
 Query:     91 LKCENLQRTGSYKIRGAYNRISRLTDEEKARGVVAASAGNHAQGVAFAARELGIRATIFM 150
               LKCENLQR GS+KIRGAY R+S LTD+E+ARGVVAASAGNHAQGVA AAR LGI A + M
 Sbjct:     39 LKCENLQRAGSFKIRGAYVRMSGLTDDERARGVVAASAGNHAQGVALAARLLGIDAMVVM 98

 Query:    151 PV 152
               PV
 Sbjct:     99 PV 100

>PD482214 (Closest domain: A5CT89_CLAM3 179-224) Number of domains in family: 1906 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC AMMONIA-LYASE FULL=PUTATIVE DEHYDRATASE FULL=L-THREONINE Length = 46 Score = 218 (88.6 bits), Expect = 4e-19 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Query:    215 LDQTPDVETVVVPIGGGGLISGVATALKLRAAEEGRTIRVVGVQAR 260
               LDQTPDVETVVVPIGGGGLISGVATALKLRAAEEGRTIRVVGVQAR
 Sbjct:    179 LDQTPDVETVVVPIGGGGLISGVATALKLRAAEEGRTIRVVGVQAR 224

>PD526846 (Closest domain: A5CT89_CLAM3 19-70) Number of domains in family: 939 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 AMMONIA-LYASE FULL=L-THREONINE CATABOLIC THREONINE BETA Length = 52 Score = 188 (77.0 bits), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 3/34 (8%)
 Query:     73 TPMESSRFLAEILGSPVHLKCENLQRTGSYKIRG 106
               TPMESSRFLAEILGSPVHLKCENLQRTGSYKIRG
 Sbjct:     37 TPMESSRFLAEILGSPVHLKCENLQRTGSYKIRG 70

>PDB5H8I3 (Closest domain: E8NBB1_MICTS 69-116) Number of domains in family: 262 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 FULL=PUTATIVE BETA FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT SUBUNIT AMMONIA-LYASE Length = 48 Score = 186 (76.3 bits), Expect = 1e-14 Identities = 38/48 (79%), Positives = 43/48 (89%), Gaps = 3/48 (6%)
 Query:    118 EKARGVVAASAGNHAQGVAFAARELGIRATIFMPVGVALPKLQATRQY 165
               E+ARGVVAASAGNHAQGVA AA++LGI ATIFMP+GV +PKL ATR Y
 Sbjct:     69 ERARGVVAASAGNHAQGVALAAQQLGIPATIFMPLGVPVPKLLATRGY 116

>PDC7L8T4 (Closest domain: F4X1E5_ACREC 163-319) Number of domains in family: 8 Commentary (automatic): SUBNAME: SYNTHETASE AMINOACYL-TRNA FULL=PUTATIVE UNCHARACTERIZED NUCLEOTIDE-BINDING FULL=BIFUNCTIONAL ATP-BINDING LIGASE BIOSYNTHESIS Length = 157 Score = 164 (67.8 bits), Expect = 1e-10 Identities = 46/152 (30%), Positives = 77/152 (50%), Gaps = 7/152 (4%)
 Query:    113 RLTDEEKARGVVAASAGNHAQGVAFAARELGIRATIFMPVGVALPKLQATRQYG-AEVIL 171
                L++E+K +GVV  S+G+ A  +   A    I  T+ MP   A  K++  + Y  A V++
 Sbjct:    167 HLSEEQKCKGVVTISSGSFAFTICHYAHHNEIPVTVVMPSTTAKEKIEMCQGYLLARVLV 226

 Query:    172 RGHTVXXXXXXXXXXXXQTGAVLIPPFDHEDVITGQATLGLEILDQTPDVETVVVP--IG 229
               RG+ +            +     +   DH ++I GQATLG+EI+ Q   ++ V++P  I 
 Sbjct:    227 RGNNLLEAHRAALDIAMREDLFYLDGNDHPNMIIGQATLGIEIMQQQSKIDVVLLPTTIK 286

 Query:    230 GGGLISGVATALKLRAAEEGRTIRVVGVQARN 261
                 GL + +A A+K   ++    I V+ VQ  N
 Sbjct:    287 NCGLTTAIAIAIKGYNSK----ITVIEVQGTN 314

>PDA026V7 (Closest domain: B0RH37_CLAMS 168-214) Number of domains in family: 680 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA SUBUNIT FULL=PUTATIVE AMMONIA-LYASE Length = 47 Score = 162 (67.0 bits), Expect = 3e-11 Identities = 34/47 (72%), Positives = 34/47 (72%), Gaps = 1/47 (2%)
 Query:    168 EVILRGHTVXXXXXXXXXXXXQTGAVLIPPFDHEDVITGQATLGLEI 214
               EVILRGHTV            QTGAVLIPPFDH DVITGQATLGLEI
 Sbjct:    168 EVILRGHTVAEPLLAAAEFAAQTGAVLIPPFDHVDVITGQATLGLEI 214

>PDB3L707 (Closest domain: D8HM05_AMYMU 73-119) Number of domains in family: 12 Commentary (automatic): SUBNAME: SCAFFOLD BIOSYNTHESIS FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT REFERENCE FULL=PUTATIVE UNCHARACTERIZED BETA SUBUNIT CYSTEINE Length = 47 Score = 157 (65.1 bits), Expect = 1e-10 Identities = 32/47 (68%), Positives = 38/47 (80%), Gaps = 2/47 (4%)
 Query:    123 VVAASAGNHAQGVAFAARELGIRATIFMPVGVALPKLQATRQYGAEV 169
               VVAASAGNHAQGVA A+  LG ++T+FMP+   LPKL ATR YGA+V
 Sbjct:     73 VVAASAGNHAQGVALASSLLGAKSTVFMPLRAPLPKLAATRGYGADV 119

>PD414066 (Closest domain: A5CT89_CLAM3 135-177) Number of domains in family: 1521 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC AMMONIA-LYASE FULL=L-THREONINE DEHYDRATASE DEAMINASE Length = 43 Score = 152 (63.2 bits), Expect = 5e-10 Identities = 31/43 (72%), Positives = 31/43 (72%), Gaps = 1/43 (2%)
 Query:    171 LRGHTVXXXXXXXXXXXXQTGAVLIPPFDHEDVITGQATLGLE 213
               LRGHTV            QTGAVLIPPFDHEDVITGQATLGLE
 Sbjct:    135 LRGHTVAEPLLAAAEFAAQTGAVLIPPFDHEDVITGQATLGLE 177

>PDA2K3G9 (Closest domain: Q3KE38_PSEPF 70-163) Number of domains in family: 166 Commentary (automatic): SUBNAME: LYASE AMMONIA-LYASE FULL=DIAMINOPROPIONATE FULL=PUTATIVE EC=4.3.1.15 DEHYDRATASE UNCHARACTERIZED ALTNAME: EC=4.3.1.19 Length = 94 Score = 150 (62.4 bits), Expect = 2e-09 Identities = 34/93 (36%), Positives = 51/93 (54%), Gaps = 1/93 (1%)
 Query:    121 RGVVAASAGNHAQGVAFAARELGIRATIFMPVGVALPKLQATRQYGAEVILRGHTVXXXX 180
               +G+V+A+ GNH Q +A AAR +G++A I +P G +L K  A R +G EV+  G       
 Sbjct:     72 KGIVSATRGNHGQSLALAARAVGLKALIVVPQGNSLEKNNAMRGFGGEVVEYGRDFDEAR 131

 Query:    181 XXXXXXXXQTGAVLIPPFDHEDVITGQATLGLE 213
                       +    L+PPF H +++ G AT  LE
 Sbjct:    132 EEAARLAQKHDLFLVPPF-HVELVKGVATYALE 163

>PDA1V4U2 (Closest domain: A8MDC1_CALMQ 86-152) Number of domains in family: 465 Commentary (automatic): SUBNAME: LYASE AMMONIA-LYASE FULL=DIAMINOPROPIONATE EC=4.3.1.15 FULL=PUTATIVE FULL=THREONINE SYNTHASE DEHYDRATASE EC=4.3.1.19 Length = 67 Score = 148 (61.6 bits), Expect = 3e-09 Identities = 30/53 (56%), Positives = 38/53 (71%), Gaps = 1/53 (1%)
 Query:    123 VVAASAGNHAQGVAFAARELGIRATIFMPVGVALPKLQATRQYGAEVILRGHT 175
               VV ASAGNHAQGVA+ A+  G+++TI MP      K+  TR+YGAEVIL G +
 Sbjct:     86 VVTASAGNHAQGVAYVAKIYGLKSTIVMPKYTPWIKISNTRKYGAEVILEGQS 138

>PDA857M8 (Closest domain: Q211Z0_RHOPB 104-214) Number of domains in family: 57 Commentary (automatic): SUBNAME: BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT LYASE FULL=THREONINE FULL=PUTATIVE EC=4.3.1.19 DEHYDRATASE UNCHARACTERIZED Length = 111 Score = 148 (61.6 bits), Expect = 6e-09 Identities = 40/113 (35%), Positives = 56/113 (49%), Gaps = 5/113 (4%)
 Query:    158 KLQATRQYGAEVILRGHTVXXXXXXXXXXXXQTGAVLIPPFDHEDVITGQATLGLEILDQ 217
               K +A R +GAE++  G                +G  ++P F H D++ G AT  LE+L  
 Sbjct:    107 KNRAMRAFGAELVEHGDDFQAAREEAGRRGEGSGLEMVPAF-HRDLVLGVATYALELLRA 165

 Query:    218 TPDVETVVVPIGGGGLISGVATALKLRAAEEGRTIRVVGVQARNAAAYPPSLA 270
               TPD+E + VPIG G  I G   A  L     G +  +VGVQ+  A +Y  S A
 Sbjct:    166 TPDLEVLYVPIGQGSGICGCILARDLL----GLSTEIVGVQSTQAPSYALSFA 214

>PDC653O7 (Closest domain: B0RH37_CLAMS 91-117) Number of domains in family: 155 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA SUBUNIT LYASE FULL=THREONINE FULL=PUTATIVE DEPENDENT FULL=PYRIDOXAL-PHOSPHATE Length = 27 Score = 147 (61.2 bits), Expect = 2e-09 Identities = 27/27 (100%), Positives = 27/27 (100%), Gaps = 3/27 (11%)
 Query:     91 LKCENLQRTGSYKIRGAYNRISRLTDE 117
               LKCENLQRTGSYKIRGAYNRISRLTDE
 Sbjct:     91 LKCENLQRTGSYKIRGAYNRISRLTDE 117

>PD387799 (Closest domain: B2V388_CLOBA 325-393) Number of domains in family: 477 Commentary (automatic): SUBNAME: KINASE FULL=GTP TRANSFERASE EC=2.7.6.5 PYROPHOSPHOKINASE SYNTHETASE FULL=PPPGPP SPOT/RELA I Length = 69 Score = 147 (61.2 bits), Expect = 4e-09 Identities = 26/68 (38%), Positives = 46/68 (67%), Gaps = 1/68 (1%)
 Query:    383 LRIMLPDRPGQLARTSQIISEANANVVEVLHTRHGRGLQISEVELEVSVETRGPEHTGEV 442
               L ++LPD+PG+L   S++I+EA  N++ + H +     + S VEL++++ET GPEH   +
 Sbjct:    326 LSVLLPDKPGELTNVSKVIAEAQGNIIRLDHNQFVSINRNSAVELKITMETFGPEHKNSI 385

 Query:    443 VQRLRDAG 450
               ++ L+D G
 Sbjct:    386 IKALKDNG 393

>PDC650L5 (Closest domain: F2HKU6_LACLV 68-101) Number of domains in family: 178 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC FULL=L-THREONINE BIOSYNTHESIS AMMONIA-LYASE ILVA Length = 34 Score = 130 (54.7 bits), Expect = 5e-07 Identities = 26/33 (78%), Positives = 29/33 (87%), Gaps = 4/33 (12%)
 Query:    120 ARGVVAASAGNHAQGVAFAARELGIRATIFMPV 152
               ++GVV ASAGNHAQGVAFAA +L I ATIFMPV
 Sbjct:     68 SKGVVCASAGNHAQGVAFAANQLNISATIFMPV 100

>PDD08828 (Closest domain: F0M4Y1_ARTPP 192-232) Number of domains in family: 3 Commentary (automatic): SUBNAME: FULL=THREONINE EC=4.3.1.19 LYASE DEHYDRATASE FULL=L-THREONINE AMMONIA-LYASE Length = 41 Score = 123 (52.0 bits), Expect = 5e-06 Identities = 26/35 (74%), Positives = 29/35 (82%), Gaps = 1/35 (2%)
 Query:    237 VATALKLRAAEEGRTIRVVGVQARNAAAYPPSLAA 271
               VA A+K RA E GR IR++GVQA NAAAYPPSLAA
 Sbjct:    192 VAVAVKARAKELGREIRIIGVQAENAAAYPPSLAA 226

>PD827414 (Closest domain: A5CT89_CLAM3 287-334) Number of domains in family: 1184 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 AMMONIA-LYASE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA SUBUNIT FULL=L-THREONINE Length = 48 Score = 121 (51.2 bits), Expect = 8e-06 Identities = 24/24 (100%), Positives = 24/24 (100%), Gaps = 5/24 (20%)
 Query:    347 TDAGRTVVILSGGNIDPLMMERVI 370
               TDAGRTVVILSGGNIDPLMMERVI
 Sbjct:    311 TDAGRTVVILSGGNIDPLMMERVI 334

>PDC677U8 (Closest domain: C3ZKV9_BRAFL 155-220) Number of domains in family: 81 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC DEHYDRATASE THREONINE FULL=PUTATIVE ILVA Length = 66 Score = 120 (50.8 bits), Expect = 1e-05 Identities = 23/49 (46%), Positives = 34/49 (69%), Gaps = 7/49 (14%)
 Query:    194 LIPPFDHEDVITGQATLGLEILDQTPDVETVVVPIGGGGLISGVATALK 242
               ++ P    DV+ GQ T+  EIL+Q   V+ +VVP+GGGG++SGV+ A K
 Sbjct:    155 MVHPNQSPDVMAGQGTMVFEILEQVERVDAIVVPVGGGGMLSGVSVAAK 203

>PDA210O4 (Closest domain: D3PPQ7_MEIRD 71-120) Number of domains in family: 232 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=PUTATIVE FULL=L-SERINE LYASE UNCHARACTERIZED EC=4.3.1.19 EC=4.3.1.17 BETA FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT Length = 50 Score = 119 (50.4 bits), Expect = 2e-05 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 7/47 (14%)
 Query:    123 VVAASAGNHAQGVAFAARELGIRATIFMPVGVALPKLQATRQYGAEV 169
               VV AS+GNH  GVAF   +LG R  +F+P G +  KL+A R+YGA V
 Sbjct:     71 VVTASSGNHGAGVAFGLAKLGARGLVFVPQGASPTKLEAIRRYGAAV 117

>PD879289 (Closest domain: A5CT89_CLAM3 245-278) Number of domains in family: 505 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT FULL=PUTATIVE AMMONIA-LYASE Length = 34 Score = 118 (50.1 bits), Expect = 2e-05 Identities = 23/23 (100%), Positives = 23/23 (100%), Gaps = 4/23 (17%)
 Query:    281 PTIADGIAVAKPGLLNFDIIRES 303
               PTIADGIAVAKPGLLNFDIIRES
 Sbjct:    245 PTIADGIAVAKPGLLNFDIIRES 267

>PDD081N0 (Closest domain: E4Y789_OIKDI 226-347) Number of domains in family: 3 Commentary (automatic): SCAFFOLD SHOTGUN ASSEMBLY SUBNAME: GENOME SET FULL=WHOLE ALLELIC SCAFFOLDA_31 SCAFFOLD_53 Length = 122 Score = 116 (49.3 bits), Expect = 0.0001 Identities = 28/86 (32%), Positives = 47/86 (54%), Gaps = 1/86 (1%)
 Query:    372 RGLAASDRYVKLRIMLPDRPGQLARTSQIISEANANVVEVLHTRHGRGLQISEVELEVSV 431
               RGL A  R ++  + + DRPG +    +I+S+  A+V EV H R      + +V L  +V
 Sbjct:    226 RGLTAEGRIMRFTVNVQDRPGGMVEMLKIVSDCGASVKEVQHDRMLLTAFVYKVALIATV 285

 Query:    432 ETRGPEHTGEVVQRLRDAGYDPRLQH 457
               ETRG E+  ++++ ++D   D    H
 Sbjct:    286 ETRGRENAQQLMKAIKDRYEDAVTFH 311

>PDC66453 (Closest domain: F8DDT5_HALXS 115-169) Number of domains in family: 110 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT FULL=PUTATIVE AMMONIA-LYASE Length = 55 Score = 108 (46.2 bits), Expect = 0.0005 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 4/54 (7%)
 Query:    158 KLQATRQYGAEVILRGHTVXXXXXXXXXXXXQTGAVLIPPFDHEDVITGQATLG 211
               K++ATR YGAEVI+ G               +TG   + PFD E ++ GQ T+G
 Sbjct:    116 KIEATRGYGAEVIVEGDIYERSYAYALERADETGETFVHPFDDEAIVAGQGTIG 169

>PD869428 (Closest domain: SDSL_HUMAN 14-71) Number of domains in family: 289 Commentary (automatic): SUBNAME: SYNTHASE FULL=THREONINE LYASE FULL=L-SERINE DEHYDRATASE FULL=PUTATIVE EC=4.2.3.1 EC=4.3.1.17 UNCHARACTERIZED Length = 58 Score = 105 (45.1 bits), Expect = 0.001 Identities = 19/34 (55%), Positives = 26/34 (76%), Gaps = 4/34 (11%)
 Query:     73 TPMESSRFLAEILGSPVHLKCENLQRTGSYKIRG 106
               TP+  S  L+++ G PV LKCEN+Q +GS+KIRG
 Sbjct:     18 TPLLESWALSQVAGMPVFLKCENVQPSGSFKIRG 51

>PD335273 (Closest domain: B1L5L0_KORCO 188-307) Number of domains in family: 702 Commentary (automatic): SUBNAME: SYNTHASE FULL=THREONINE LYASE EC=4.2.3.1 FULL=L-THREONINE REFERENCE THREONINE FULL=PUTATIVE THRC Length = 120 Score = 104 (44.7 bits), Expect = 0.004 Identities = 32/91 (35%), Positives = 46/91 (50%), Gaps = 2/91 (2%)
 Query:    204 ITGQATLGLEILDQTPDVETVVVPIGGGGLISGVATALK-LRA-AEEGRTIRVVGVQARN 261
               + GQ TL  EI D+    + V++P+G  G IS +    K L++     R  R+VGVQAR 
 Sbjct:    198 LEGQKTLAYEISDELGVPDWVILPVGNAGNISALWKGFKELKSLGLIDRLPRLVGVQARG 257

 Query:    262 AAAYPPSLAAGRATEIEITPTIADGIAVAKP 292
               A+    +   GR    E   T+A  I + KP
 Sbjct:    258 ASPIVRAFREGRMEFFERPETVATAIRIGKP 288

>PDC69598 (Closest domain: D1BP10_VEIPT 47-71) Number of domains in family: 61 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 FULL=PUTATIVE THREONINE UNCHARACTERIZED AMMONIA-LYASE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT Length = 25 Score = 104 (44.7 bits), Expect = 0.001 Identities = 19/25 (76%), Positives = 25/25 (100%), Gaps = 1/25 (4%)
 Query:     99 TGSYKIRGAYNRISRLTDEEKARGV 123
               TGS+K+RGAYN+I++LT+EEKARGV
 Sbjct:     47 TGSFKVRGAYNKIAKLTEEEKARGV 71

>PDB4F142 (Closest domain: C7QZX9_JONDD 358-400) Number of domains in family: 2 Commentary (automatic): SUBNAME: FULL=THREONINE FULL=PUTATIVE DEHYDRATASE UNCHARACTERIZED Length = 43 Score = 103 (44.3 bits), Expect = 0.002 Identities = 20/42 (47%), Positives = 29/42 (69%), Gaps = 4/42 (9%)
 Query:    406 ANVVEVLHTRHGRGLQISEVELEVSVETRGPEHTGEVVQRLR 447
               AN++ V H R G  L I EVE+ + VET+GPEH  E+++ +R
 Sbjct:    358 ANIMHVDHVRTGVDLAIDEVEVTMQVETKGPEHCAELLEFMR 399

>PD925716 (Closest domain: Q4A0K4_STAS1 61-112) Number of domains in family: 3520 Commentary (automatic): BIOSYNTHESIS SYNTHASE FULL=CYSTEINE EC=2.5.1.47 TRANSFERASE RECNAME: CYSTEINE AMINO-ACID SUBNAME: LYASE Length = 52 Score = 100 (43.1 bits), Expect = 0.006 Identities = 24/48 (50%), Positives = 28/48 (58%), Gaps = 5/48 (10%)
 Query:    123 VVAASAGNHAQGVAFAARELGIRATIFMPVGVALPKLQATRQYGAEVI 170
               VV ASAGN   GVA AA   G+ A IF P G +  K+   +  GAEVI
 Sbjct:     62 VVEASAGNTGIGVAIAANHYGVSAVIFAPEGFSEEKISIIKALGAEVI 109