Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PDA0U080 score=190 PDB020B7 score=131 PD351786 score=242 PD690281 score=364 PDA9Z6V1 score=481 PD690281 score=364 PD186234 score=333 PDA1L523 score=315 PDB00405 score=196 PD471754 score=260


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PDA9Z6V1
PD690281
PD186234
PDA1L523
PD471754
PD351786
PD331496
PDB00405
PDA0U080
PD892055
PD041942
PDE20283
PDB020B7
PD715843
PD000897
PDA239A2
PDA1S6D5
PDA5C2J6
PDC56346
PDA9Z7A1
PD311278
PDA1F7F0
PDD318G6

Domain 3D modelling using Swiss-Model

Domain IDBEGINEND 
PDA9Z6V1
PD690281
PD186234
PDA1L523
PD471754
PD892055

Domain 3D modelling using Geno3D

Domain IDBEGINEND 
PDA9Z6V1
PD690281
PD186234
PDA1L523
PD471754
PD892055


HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(388 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

    10-113  #PDB020B7                                            131 6e-07
     10-45  #PDA0U080                                            190 1e-15
    58-110  #PDA1F7F0                                            100 0.007
    58-105  #PD351786                                            242 7e-23
    60-280  #PD690281                                            364 6e-38
    65-162  #PDE20283                                            133 5e-07
    75-221  #PD000897                                            126 1e-05
    76-114  #PD311278                                            102 0.002
    76-119  #PD715843                                            130 4e-07
    98-222  #PD331496                                            234 8e-21
   103-160  #PD892055                                            147 2e-09
   121-210  #PDA9Z6V1                                            481 1e-56
   122-259  #PD041942                                            136 3e-07
   163-221  #PDC56346                                            112 0.0001
   180-215  #PDD318G6                                             98 0.007
   203-305  #PDA1L523                                            315 2e-32
   205-248  #PDA239A2                                            122 6e-06
   230-279  #PDA1S6D5                                            114 6e-05
   233-295  #PD186234                                            333 2e-35
   297-369  #PDB00405                                            196 7e-16
   318-371  #PD471754                                            260 3e-25
   325-371  #PDA5C2J6                                            113 0.0001
   329-369  #PDA9Z7A1                                            111 0.0002


>PDA9Z6V1 (Closest domain: Q6G8L1_STAAS 112-201)
Number of domains in family: 3281
Commentary (automatic):
SUBNAME: PYRIDOXAL PHOSPHATE TRANSFERASE FULL=CYSTEINE DESULFURASE EC=2.8.1.7 AMINOTRANSFERASE RECNAME: CLASS  
Length = 90
Score = 481  (189.9 bits), Expect = 1e-56
Identities = 90/90 (100%), Positives = 90/90 (100%)

 Query:    121 HEGFKVKYVDVKKDGSINLEHFKELMSDKVGLVTCMYVNNVTGQIQPIPQMAKVIKNYPK 180
               HEGFKVKYVDVKKDGSINLEHFKELMSDKVGLVTCMYVNNVTGQIQPIPQMAKVIKNYPK
 Sbjct:    112 HEGFKVKYVDVKKDGSINLEHFKELMSDKVGLVTCMYVNNVTGQIQPIPQMAKVIKNYPK 171

 Query:    181 AHFHVDAVQAFGKISMDLNNIDSISLSGHK 210
               AHFHVDAVQAFGKISMDLNNIDSISLSGHK
 Sbjct:    172 AHFHVDAVQAFGKISMDLNNIDSISLSGHK 201

>PD690281 (Closest domain: F2LIV9_BURGS 60-282) Number of domains in family: 4402 Commentary (automatic): FULL=GLYCINE ALTNAME: RECNAME: DEHYDROGENASE SUBUNIT PYRIDOXAL EC=1.4.4.2 CLEAVAGE DECARBOXYLASE DECARBOXYLATING Length = 223 Score = 364 (144.8 bits), Expect = 6e-38 Identities = 86/225 (38%), Positives = 130/225 (57%), Gaps = 8/225 (3%)
 Query:     60 QINAMINSKTNYDVVFTSGATESNNLALKGIAYRKFDTAKEIITSVLEHPSVLEVVRYLE 119
               Q+ A+I +  + ++V+TSGATESNNLALKG A +  +  + +ITS +EH ++L+ +  L 
 Sbjct:     60 QVAALIGADAD-EIVWTSGATESNNLALKGYADKAGER-RHLITSRIEHKAILDTMASLA 117

 Query:    120 AHEGFKVKYVDVKKDGSINLEHFKELMSDKVGLVTCMYVNNVTGQIQPIPQMAKVIKNYP 179
                H GF V Y+    +G I+ E   E ++   GLV+ M VNN  G +  I  +A+V+ +  
 Sbjct:    118 KH-GFVVSYLAPAPNGEISAEAVTEAIAPDTGLVSLMLVNNEIGTLSDIAAIARVV-HAA 175

 Query:    180 KAHFHVDAVQAFGKISMDLN--NIDSISLSGHKFNGLKGQGVLLVNH--IQNVEPTVHGG 235
                A  HVDA QA GK ++D+    ID +S+S HK  G KG G L V     + + P +HGG
 Sbjct:    176 GALLHVDAAQALGKTAIDVRALGIDMLSMSAHKVYGPKGIGALYVRREIAERIAPQMHGG 235

 Query:    236 GQEYGVRSGTVNLPNDIAMVKAMKIANENFEALNAFVTELNNDVR 280
               G E G+RSGT+     + M  A ++A    E+  A +  L+  +R
 Sbjct:    236 GHERGLRSGTLATHQIVGMGTACEVAAAALESDTARIATLSEGLR 280

>PD186234 (Closest domain: C8N1C1_STAAU 233-295) Number of domains in family: 2944 Commentary (automatic): PYRIDOXAL PHOSPHATE SUBNAME: TRANSFERASE DESULFURASE FULL=CYSTEINE EC=2.8.1.7 AMINOTRANSFERASE RECNAME: CLASS Length = 63 Score = 333 (132.9 bits), Expect = 2e-35 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 8/63 (12%)
 Query:    233 HGGGQEYGVRSGTVNLPNDIAMVKAMKIANENFEALNAFVTELNNDVRQFLNKYHGVYIN 292
               HGGGQEYGVRSGTVNLPNDIAMVKAMKIANENFEALNAFVTELNNDVRQFLNKYHGVYIN
 Sbjct:    233 HGGGQEYGVRSGTVNLPNDIAMVKAMKIANENFEALNAFVTELNNDVRQFLNKYHGVYIN 292

 Query:    293 SST 295
               SST
 Sbjct:    293 SST 295

>PDA1L523 (Closest domain: C5QT92_STAEP 194-296) Number of domains in family: 397 Commentary (automatic): SUBNAME: PHOSPHATE PYRIDOXAL TRANSFERASE AMINOTRANSFERASE FULL=CYSTEINE DESULFURASE CLASS EC=2.8.1.7 V Length = 103 Score = 315 (125.9 bits), Expect = 2e-32 Identities = 60/103 (58%), Positives = 77/103 (74%), Gaps = 6/103 (5%)
 Query:    203 SISLSGHKFNGLKGQGVLLVNHIQNVEPTVHGGGQEYGVRSGTVNLPNDIAMVKAMKIAN 262
               S+SLSGHKFNGLKGQG+LL+ +IQN+EP +HGGGQEYG+RSGTVNLP  I+MVKA+K A 
 Sbjct:    194 SLSLSGHKFNGLKGQGLLLIKNIQNIEPVIHGGGQEYGLRSGTVNLPMAISMVKAIKQAV 253

 Query:    263 ENFEALNAFVTELNNDVRQFLNKYHGVYINSSTSGSPFVLNIS 305
               +  E  N  +   N  +  FL  + GVYINS  +G+P ++NI 
 Sbjct:    254 QGTEETNRKLKLFNQAIVTFLKDFKGVYINSPENGAPHIINIG 296

>PD471754 (Closest domain: G0LUV6_STAAU 318-378) Number of domains in family: 1336 Commentary (automatic): SUBNAME: PHOSPHATE PYRIDOXAL TRANSFERASE DESULFURASE FULL=CYSTEINE AMINOTRANSFERASE EC=2.8.1.7 V CLASS Length = 61 Score = 260 (104.8 bits), Expect = 3e-25 Identities = 54/54 (100%), Positives = 54/54 (100%), Gaps = 9/54 (16%)
 Query:    318 FSKYDIMISTTSACSSKRNKLNEVLAAMGLSDKSIEGSIRLSFGATTTKEDIAR 371
               FSKYDIMISTTSACSSKRNKLNEVLAAMGLSDKSIEGSIRLSFGATTTKEDIAR
 Sbjct:    318 FSKYDIMISTTSACSSKRNKLNEVLAAMGLSDKSIEGSIRLSFGATTTKEDIAR 371

>PD351786 (Closest domain: Q2FG22_STAA3 44-96) Number of domains in family: 2992 Commentary (automatic): PYRIDOXAL PHOSPHATE SUBNAME: TRANSFERASE FULL=CYSTEINE DESULFURASE EC=2.8.1.7 RECNAME: AMINOTRANSFERASE CLASS Length = 53 Score = 242 (97.8 bits), Expect = 7e-23 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 4/48 (8%)
 Query:     58 KTQINAMINSKTNYDVVFTSGATESNNLALKGIAYRKFDTAKEIITSV 105
               KTQINAMINSKTNYDVVFTSGATESNNLALKGIAYRKFDTAKEIITSV
 Sbjct:     49 KTQINAMINSKTNYDVVFTSGATESNNLALKGIAYRKFDTAKEIITSV 96

>PD331496 (Closest domain: G2LNP2_BUCUM 90-221) Number of domains in family: 1097 Commentary (automatic): SUBNAME: DECARBOXYLASE LYASE PHOSPHATE PYRIDOXAL FULL=ORN/LYS/ARG FULL=PUTATIVE FULL=PYRIDOXAL-DEPENDENT MAJOR SYNTHASE Length = 132 Score = 234 (94.7 bits), Expect = 8e-21 Identities = 59/127 (46%), Positives = 77/127 (60%), Gaps = 4/127 (3%)
 Query:     98 AKEIITSVLEHPSVLEVVRYLEAHEGFKVKYVDVKKDGSINLEHFKELMSDKVGLVTCMY 157
                K IITS  EH SVL+  RYLE+ +GF V Y+  K +G I+L   K  +     L++ M+
 Sbjct:     94 GKHIITSKTEHKSVLDSCRYLES-KGFHVTYLTPKNNGIIDLNDLKNSIQKDTILISIMH 152

 Query:    158 VNNVTGQIQPIPQMAKVIKNYPKAHFHVDAVQAFGKISMDLN--NIDSISLSGHKFNGLK 215
               VNN  G IQ I  ++K+ KNY    FHVDA Q+ GKI ++LN  +ID +S S HK  G K
 Sbjct:    153 VNNEIGIIQDINSISKICKNY-NIFFHVDATQSIGKIPINLNAIDIDLMSFSAHKVYGPK 211

 Query:    216 GQGVLLV 222
               G G L V
 Sbjct:    212 GIGGLYV 218

>PDB00405 (Closest domain: F4A042_MAHA5 290-379) Number of domains in family: 734 Commentary (automatic): SUBNAME: PYRIDOXAL PHOSPHATE TRANSFERASE DESULFURASE FULL=CYSTEINE AMINOTRANSFERASE EC=2.8.1.7 CLASS V Length = 90 Score = 196 (80.1 bits), Expect = 7e-16 Identities = 38/73 (52%), Positives = 51/73 (69%), Gaps = 6/73 (8%)
 Query:    297 GSPFVLNISFPGVKGEVLVNAFSKYDIMISTTSACSSKRNKLNEVLAAMGLSDKSIEGSI 356
               G+P +LNISF GV+GEVLV+A  +  I +ST SACSS++ K++ VL AMGL   S E +I
 Sbjct:    292 GAPHILNISFNGVRGEVLVHALEQEGIYVSTGSACSSRKQKVSHVLKAMGLPTASCESAI 351

 Query:    357 RLSFGATTTKEDI 369
               R S     T++DI
 Sbjct:    352 RFSLSTLNTQDDI 364

>PDA0U080 (Closest domain: Q7A548_STAAN 1-41) Number of domains in family: 3650 Commentary (automatic): SUBNAME: PYRIDOXAL PHOSPHATE TRANSFERASE DESULFURASE FULL=CYSTEINE EC=2.8.1.7 AMINOTRANSFERASE RECNAME: CLASS Length = 41 Score = 190 (77.8 bits), Expect = 1e-15 Identities = 35/36 (97%), Positives = 36/36 (100%), Gaps = 3/36 (8%)
 Query:     10 LIYLDNAATTKAFEEVLDTYLKVNQSMYYNPNSPHK 45
               +IYLDNAATTKAFEEVLDTYLKVNQSMYYNPNSPHK
 Sbjct:      1 MIYLDNAATTKAFEEVLDTYLKVNQSMYYNPNSPHK 36

>PD892055 (Closest domain: B7JA84_ACIF2 95-153) Number of domains in family: 908 Commentary (automatic): PHOSPHATE PYRIDOXAL SUBNAME: TRANSFERASE DESULFURASE FULL=CYSTEINE EC=2.8.1.7 AMINOTRANSFERASE RECNAME: CLASS Length = 59 Score = 147 (61.2 bits), Expect = 2e-09 Identities = 26/58 (44%), Positives = 42/58 (72%), Gaps = 1/58 (1%)
 Query:    103 TSVLEHPSVLEVVRYLEAHEGFKVKYVDVKKDGSINLEHFKELMSDKVGLVTCMYVNN 160
               TSV+EHP++L +  +LE HEG+KV Y+ V + G I++E +   +S++V +V+ MY NN
 Sbjct:     95 TSVVEHPAILSLCDHLERHEGYKVHYIPVDRLGRISMEAYAAALSEQVAVVSMMYANN 152

>PD041942 (Closest domain: D3DID6_HYDTT 95-245) Number of domains in family: 11 Commentary (automatic): SUBNAME: FULL=NIFS-LIKE RECNAME: FULL=AMINOTRANSFERASE AMINOTRANSFERASE TRANSFERASE V CLASS FULL=BA71V-QP383R CLUSTER Length = 151 Score = 136 (57.0 bits), Expect = 3e-07 Identities = 41/140 (29%), Positives = 68/140 (48%), Gaps = 2/140 (1%)
 Query:    122 EGFKVKYVDVKKDGSINLEHFKELMSDKVGLVTCMYVNNVTGQIQPIPQMAKVIKNY-PK 180
               EG  V Y+   + G I+ E  +E + +   +VT   V   T  ++ I  + KV+K   PK
 Sbjct:    106 EGLNVLYLTTDRYGWIDPELIREHVKEDTLMVTMGAVCRETAALRDIVGIVKVVKETNPK 165

 Query:    181 AHFHVDAVQAF-GKISMDLNNIDSISLSGHKFNGLKGQGVLLVNHIQNVEPTVHGGGQEY 239
                  H D    +   + +D+  +D  S  G    G +G G+L +     ++P + GG QE 
 Sbjct:    166 TLCHFDFWGLYYPDMVVDVELLDMASFDGPSLLGPQGVGILYLKKGIRLKPIIEGGTQER 225

 Query:    240 GVRSGTVNLPNDIAMVKAMK 259
               G+R+G  NL    AM +++K
 Sbjct:    226 GLRAGEENLFGIYAMSQSIK 245

>PDE20283 (Closest domain: Q2RGD6_MOOTA 27-152) Number of domains in family: 1 Commentary (automatic): SUBNAME: REFERENCE PHOSPHATE PYRIDOXAL FULL=PUTATIVE UNCHARACTERIZED Length = 126 Score = 133 (55.8 bits), Expect = 5e-07 Identities = 32/98 (32%), Positives = 50/98 (51%), Gaps = 6/98 (6%)
 Query:     65 INSKTNYDVVFTSGATESNNLALKGIAYRKFDTAKEIITSVLEHPSVLEVVRYLEAHEGF 124
               IN  T   +VFT+ ATE+ NLALKG      +    +IT+ +EH +V   ++ LE   G 
 Sbjct:     61 INDATR--IVFTANATEAINLALKGW----LNPGDHVITTAMEHNAVWRCLKTLEKERGI 114

 Query:    125 KVKYVDVKKDGSINLEHFKELMSDKVGLVTCMYVNNVT 162
                +  V  ++DG + L         +  L+ C + +NVT
 Sbjct:    115 SITVVPCREDGELLLPELDAAFRKETRLLACTHASNVT 152

>PDB020B7 (Closest domain: F7V8C1_CLOSS 1-103) Number of domains in family: 226 Commentary (automatic): SUBNAME: FULL=CYSTEINE DESULFURASE FAMILY PHOSPHATE PYRIDOXAL TRANSFERASE LYASE AMINOTRANSFERASE EC=2.8.1.7 Length = 103 Score = 131 (55.1 bits), Expect = 6e-07 Identities = 37/105 (35%), Positives = 54/105 (51%), Gaps = 5/105 (4%)
 Query:     10 LIYLDNAATT-KAFEEVLDTYLKVNQSMYYNPNSPHKXXXXXXXXXXXXKTQINAMINSK 68
               +IYLDNAATT K  ++VLD  L   Q++       H             + +++   +++
 Sbjct:      1 MIYLDNAATTLKKPKQVLDAVLTAMQTIGNAGRGVHGASLGAARTVFDTRKKVSDFFHAE 60

 Query:     69 TNYDVVFTSGATESNNLALKGIAYRKFDTAKEIITSVLEHPSVLE 113
                   V FT  +TE+ N+ALKGI     +    +ITSVLEH SVL 
 Sbjct:     61 GPSQVAFTCNSTEALNIALKGI----LNPGDHVITSVLEHNSVLR 101

>PD715843 (Closest domain: A0LM34_SYNFM 70-113) Number of domains in family: 112 Commentary (automatic): SUBNAME: DESULFURASE TRANSFERASE PHOSPHATE PYRIDOXAL FULL=CYSTEINE EC=2.8.1.7 AMINOTRANSFERASE RECNAME: V Length = 44 Score = 130 (54.7 bits), Expect = 4e-07 Identities = 28/44 (63%), Positives = 32/44 (72%), Gaps = 1/44 (2%)
 Query:     76 TSGATESNNLALKGIAYRKFDTAKEIITSVLEHPSVLEVVRYLE 119
               TSG TESNN A+KGIA+        IITSV+EHP+VLEV  YLE
 Sbjct:     70 TSGGTESNNHAIKGIAFANRARGNHIITSVIEHPAVLEVCDYLE 113

>PD000897 (Closest domain: O27989_ARCFU 78-306) Number of domains in family: 2655 Commentary (automatic): LYASE SUBNAME: PHOSPHATE PYRIDOXAL DECARBOXYLASE FULL=GLUTAMATE FULL=PUTATIVE UNCHARACTERIZED EC=4.1.1.15 REFERENCE Length = 229 Score = 126 (53.1 bits), Expect = 1e-05 Identities = 52/166 (31%), Positives = 75/166 (45%), Gaps = 25/166 (15%)
 Query:     75 FTSGATESNNLALKGIA--YRKFD-TAK--EIITSVLEHPSVLEVVRYLEAHEGFKVKYV 129
               FT G TES  LA+K     YRK + TA+  EI+  +  HP+ L+   YL    G KV  +
 Sbjct:     86 FTFGGTESIMLAVKAARDYYRKKEGTAEVPEILAPISIHPAFLKAADYL----GLKVVRL 141

 Query:    130 DVKKDGSINLEHFKELMSDKVGLVTCMYVNNVTGQIQPIPQMAKVIKNYPKAHFHVDAV- 188
                VK D   +++ F E +S K  L+     N   G I P+ ++A++         HVDA  
 Sbjct:    142 PVK-DAKGDVDAFAEAVSGKTALIALSAPNWPFGTIDPVEEIAEIAAER-NVLLHVDACL 199

 Query:    189 ------------QAFGKISMDLNNIDSISLSGHKFN-GLKGQGVLL 221
                           +   K    +  + SISL  HK+    KG  V+L
 Sbjct:    200 GGFILPFFEMLGEKIPKFDFRVEGVTSISLDAHKYGYAPKGASVVL 245

>PDA239A2 (Closest domain: F0T3T3_CHLP6 187-252) Number of domains in family: 55 Commentary (automatic): SUBNAME: PYRIDOXAL PHOSPHATE DESULFURASE FULL=CYSTEINE CYSTEINE FULL=PUTATIVE TRANSFERASE DESULFARASE AMINOTRANSFERASE Length = 66 Score = 122 (51.6 bits), Expect = 6e-06 Identities = 24/44 (54%), Positives = 30/44 (68%), Gaps = 1/44 (2%)
 Query:    205 SLSGHKFNGLKGQGVLLVNHIQNVEPTVHGGGQEYGVRSGTVNL 248
               + SGHKF+ L G G LLV+    + P + GGGQ+ GVRSGT NL
 Sbjct:    187 AFSGHKFHALSGIGALLVSSGVKISPLIWGGGQQGGVRSGTENL 230

>PDA1S6D5 (Closest domain: D2ZRZ4_METSM 219-272) Number of domains in family: 242 Commentary (automatic): SUBNAME: PHOSPHATE PYRIDOXAL TRANSFERASE DESULFURASE FULL=CYSTEINE LYASE AMINOTRANSFERASE EC=2.8.1.7 FULL=AMINOTRANSFERASE Length = 54 Score = 114 (48.5 bits), Expect = 6e-05 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Query:    230 PTVHGGGQEYGVRSGTVNLPNDIAMVKAMKIANENFEALNAFVTELNNDV 279
               P +HGGGQE G+RSGT N+P  +   KA +IAN N E   A + +  +++
 Sbjct:    219 PLIHGGGQERGIRSGTENVPGIVGFGKACEIANNNLEENYARLVKTRDEI 268

>PDA5C2J6 (Closest domain: G2LI14_CHLTF 328-384) Number of domains in family: 207 Commentary (automatic): SUBNAME: TRANSFERASE PHOSPHATE PYRIDOXAL DESULFURASE FULL=CYSTEINE AMINOTRANSFERASE EC=2.8.1.7 LYASE FULL=PUTATIVE Length = 57 Score = 113 (48.1 bits), Expect = 0.0001 Identities = 24/47 (51%), Positives = 30/47 (63%), Gaps = 1/47 (2%)
 Query:    325 ISTTSACSSKRNKLNEVLAAMGLSDKSIEGSIRLSFGATTTKEDIAR 371
               +ST SACSS   + + VL AMGL  + + GSIR+S    TT  DIAR
 Sbjct:    329 VSTGSACSSGTTEPSHVLRAMGLPPERVRGSIRVSLSQETTAADIAR 375

>PDC56346 (Closest domain: Q9ZD59_RICPR 147-206) Number of domains in family: 3 Commentary (automatic): SUBNAME: LYASE FULL=SELENOCYSTEINE HOMOLOG REFERENCE PHOSPHATE PYRIDOXAL FULL=NIFS SPL1 CSF1 Length = 60 Score = 112 (47.8 bits), Expect = 0.0001 Identities = 26/61 (42%), Positives = 38/61 (62%), Gaps = 3/61 (4%)
 Query:    163 GQIQPIPQMAKVIKNYPKAHFHVDAVQAFGKISMDLNN--IDSISLSGHKFNGLKGQGVL 220
               G +Q I  ++K+ K Y  A FH D VQ+FGKIS+++    +D  ++SGHK  G  G G L
 Sbjct:    147 GVLQDIAAISKITKKY-NAKFHSDLVQSFGKISLNIKELGLDFATISGHKIGGGHGCGAL 205

 Query:    221 L 221
               +
 Sbjct:    206 I 206

>PDA9Z7A1 (Closest domain: Q9RME8_ZYMMB 311-368) Number of domains in family: 1431 Commentary (automatic): PYRIDOXAL PHOSPHATE FULL=CYSTEINE TRANSFERASE DESULFURASE SUBNAME: EC=2.8.1.7 RECNAME: AMINOTRANSFERASE FULL=PUTATIVE Length = 58 Score = 111 (47.4 bits), Expect = 0.0002 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Query:    329 SACSSKRNKLNEVLAAMGLSDKSIEGSIRLSFGATTTKEDI 369
               SACSS   + + VL A+GLS K++ GSIR+ FG  TT+E++
 Sbjct:    311 SACSSGNGRPSHVLKALGLSQKAVRGSIRIGFGRYTTEEEL 351

>PD311278 (Closest domain: Q4L6W9_STAHJ 67-108) Number of domains in family: 117 Commentary (automatic): SUBNAME: PHOSPHATE PYRIDOXAL TRANSFERASE DESULFURASE FULL=CYSTEINE AMINOTRANSFERASE EC=2.8.1.7 V CLASS Length = 42 Score = 102 (43.9 bits), Expect = 0.002 Identities = 22/39 (56%), Positives = 26/39 (66%), Gaps = 1/39 (2%)
 Query:     76 TSGATESNNLALKGIAYRKFDTAKEIITSVLEHPSVLEV 114
               TSGATESNN A+KG+ Y        IIT+ +EH SVL V
 Sbjct:     67 TSGATESNNTAIKGLVYANEHLGNHIITTKIEHHSVLHV 105

>PDA1F7F0 (Closest domain: D7G5K2_ECTSI 73-159) Number of domains in family: 2173 Commentary (automatic): PYRIDOXAL PHOSPHATE TRANSFERASE FULL=CYSTEINE DESULFURASE EC=2.8.1.7 SUBNAME: RECNAME: LYASE FULL=SELENOCYSTEINE Length = 87 Score = 100 (43.1 bits), Expect = 0.007 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 1/53 (1%)
 Query:     58 KTQINAMINSKTNYDVVFTSGATESNNLALKGIAYRKFDTAKEIITSVLEHPS 110
               + ++ A +N++T+ ++VFT GATE+ NL  +           EI+T+V+EH S
 Sbjct:     96 REKVGAFVNAETSREIVFTRGATEAINLVAQTWGLDNLAAGDEIVTTVMEHHS 148

>PDD318G6 (Closest domain: B0W8U7_CULQU 108-151) Number of domains in family: 2 Commentary (automatic): SUBNAME: DESULFURASE FULL=CYSTEINE MITOCHONDRIAL MITOCHONDRIAL Length = 44 Score = 98 (42.4 bits), Expect = 0.007 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 2/38 (5%)
 Query:    180 KAHFHVDAVQAFGKISMDLN--NIDSISLSGHKFNGLK 215
               K  FH DA QA GK+ +D+N  NID +S+SGHK  G K
 Sbjct:    114 KVFFHTDAAQAVGKVPIDVNKMNIDLMSISGHKLYGPK 151