Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PD526846 score=237 PD786156 score=228 PDA1V4U2 score=174 PD414066 score=224 PDA857M8 score=165 PD879289 score=156 PDA857O4 score=134 PD827414 score=148 PDA1F5E7 score=353


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PDA1F5E7
PD526846
PD786156
PD414066
PDA1V4U2
PDA857M8
PDA2K3G9
PDC66453
PD879289
PD827414
PDB5H8I3
PDA026V7
PDA857O4
PDC657H6
PD482214
PDB3L707
PDC7L8T4
PDA210O4
PDC677U8
PD387799
PDB1O9V8
PD869428
PD925716

Domain 3D modelling using Swiss-Model

Domain IDBEGINEND 
PD786156
PD414066
PDA2K3G9
PDB5H8I3

Domain 3D modelling using Geno3D

Domain IDBEGINEND 
PD786156
PD414066
PDA2K3G9
PDB5H8I3


HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(428 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

     42-81  #PD526846                                            237 5e-22
     47-81  #PD869428                                            102 0.003
    66-129  #PD786156                                            228 2e-20
    86-200  #PDC7L8T4                                            120 3e-05
    97-140  #PDB5H8I3                                            145 4e-09
    98-164  #PDA1V4U2                                            174 8e-13
    98-144  #PD925716                                             99 0.008
    98-147  #PDA210O4                                            114 6e-05
    98-144  #PDB3L707                                            125 3e-06
    98-185  #PDA2K3G9                                            159 1e-10
   133-241  #PDA857M8                                            165 3e-11
   138-186  #PDC66453                                            157 1e-10
   141-183  #PDC657H6                                            129 6e-07
   142-189  #PDA026V7                                            141 2e-08
   146-188  #PD414066                                            224 4e-20
   168-192  #PDC677U8                                            111 0.0002
   169-226  #PDB1O9V8                                            107 0.0008
   190-231  #PD482214                                            125 2e-06
   250-280  #PD879289                                            156 1e-10
   251-332  #PDA857O4                                            134 3e-07
   313-339  #PD827414                                            148 1e-09
   355-422  #PDA1F5E7                                            353 1e-37
   359-416  #PD387799                                            108 0.0005


>PDA1F5E7 (Closest domain: E0THN2_PARBH 342-422)
Number of domains in family: 442
Commentary (automatic):
SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 AMMONIA-LYASE FULL=L-THREONINE REFERENCE FULL=PUTATIVE THREONINE  
Length = 81
Score = 353  (140.6 bits), Expect = 1e-37
Identities = 68/68 (100%), Positives = 68/68 (100%)

 Query:    355 VPLMDVPGQLTRVSAAIGAAGGNVIDVSYHKVFNDLPAKQTHLDISVEATGPAHMDRIVE 414
               VPLMDVPGQLTRVSAAIGAAGGNVIDVSYHKVFNDLPAKQTHLDISVEATGPAHMDRIVE
 Sbjct:    355 VPLMDVPGQLTRVSAAIGAAGGNVIDVSYHKVFNDLPAKQTHLDISVEATGPAHMDRIVE 414

 Query:    415 ALRAEGLE 422
               ALRAEGLE
 Sbjct:    415 ALRAEGLE 422

>PD526846 (Closest domain: E0THN2_PARBH 42-81) Number of domains in family: 939 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 AMMONIA-LYASE FULL=L-THREONINE CATABOLIC THREONINE BETA Length = 40 Score = 237 (95.9 bits), Expect = 5e-22 Identities = 40/40 (100%), Positives = 40/40 (100%)
 Query:     42 WQEIRETPCLPSRKLGALTNCRLWLKYENLQYIGAFKERG 81
               WQEIRETPCLPSRKLGALTNCRLWLKYENLQYIGAFKERG
 Sbjct:     42 WQEIRETPCLPSRKLGALTNCRLWLKYENLQYIGAFKERG 81

>PD786156 (Closest domain: D8JP03_ACISD 48-111) Number of domains in family: 1947 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC DEHYDRATASE AMMONIA-LYASE THREONINE FULL=L-THREONINE Length = 64 Score = 228 (92.4 bits), Expect = 2e-20 Identities = 44/64 (68%), Positives = 52/64 (81%)
 Query:     66 LKYENLQYIGAFKERGALAKLLSLSDAERQSGVVAASAGNHAQGLARHAELLGIRATIVM 125
               LK+ENLQ+  +FKERGAL KLL LSD E+Q GV+AASAGNHAQG+A HA+  G+ ATIVM
 Sbjct:     48 LKFENLQFTASFKERGALNKLLCLSDQEKQHGVIAASAGNHAQGVAYHAQRTGVTATIVM 107

 Query:    126 PAQT 129
               P  T
 Sbjct:    108 PKST 111

>PD414066 (Closest domain: E0THN2_PARBH 146-188) Number of domains in family: 1521 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC AMMONIA-LYASE FULL=L-THREONINE DEHYDRATASE DEAMINASE Length = 43 Score = 224 (90.9 bits), Expect = 4e-20 Identities = 43/43 (100%), Positives = 43/43 (100%)
 Query:    146 LHGTDFEAAHAEAIRQVEEEGKTLVHPFDDPYVAAGQGTIAKE 188
               LHGTDFEAAHAEAIRQVEEEGKTLVHPFDDPYVAAGQGTIAKE
 Sbjct:    146 LHGTDFEAAHAEAIRQVEEEGKTLVHPFDDPYVAAGQGTIAKE 188

>PDA1V4U2 (Closest domain: A8MDC1_CALMQ 86-152) Number of domains in family: 465 Commentary (automatic): SUBNAME: LYASE AMMONIA-LYASE FULL=DIAMINOPROPIONATE EC=4.3.1.15 FULL=PUTATIVE FULL=THREONINE SYNTHASE DEHYDRATASE EC=4.3.1.19 Length = 67 Score = 174 (71.6 bits), Expect = 8e-13 Identities = 34/67 (50%), Positives = 47/67 (70%)
 Query:     98 VVAASAGNHAQGLARHAELLGIRATIVMPAQTPSVKVEETKRFGAEVILHGTDFEAAHAE 157
               VV ASAGNHAQG+A  A++ G+++TIVMP  TP +K+  T+++GAEVIL G  +  A   
 Sbjct:     86 VVTASAGNHAQGVAYVAKIYGLKSTIVMPKYTPWIKISNTRKYGAEVILEGQSYYEAEKY 145

 Query:    158 AIRQVEE 164
               AI   +E
 Sbjct:    146 AIELTKE 152

>PDA857M8 (Closest domain: D1C1H4_SPHTD 113-225) Number of domains in family: 57 Commentary (automatic): SUBNAME: BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT LYASE FULL=THREONINE FULL=PUTATIVE EC=4.3.1.19 DEHYDRATASE UNCHARACTERIZED Length = 113 Score = 165 (68.2 bits), Expect = 3e-11 Identities = 39/109 (35%), Positives = 57/109 (52%), Gaps = 1/109 (0%)
 Query:    133 KVEETKRFGAEVILHGTDFEAAHAEAIRQVEEEGKTLVHPFDDPYVAAGQGTIAKEMLCE 192
               KV   +R GAEV+L G DF+ A   A  + E +G   +H  ++P + AG GT A EM+  
 Sbjct:    116 KVASMRRLGAEVVLTGRDFDEARLAAEERAERDGMRYIHSANEPDLIAGVGTYALEMIEA 175

 Query:    193 APEIDTLVXXXXXXXXXXXXXXVAKEMRPDIRIIGVQAALYPGMANAVR 241
                P++DT++              V K + P IR+IGVQ+   P +  A R
 Sbjct:    176 VPDLDTVIVPVGAGSGVCGTAIVMKAVNPAIRVIGVQSEEMPVVYRAWR 224

>PDA2K3G9 (Closest domain: G0NWB6_CAEBE 149-238) Number of domains in family: 166 Commentary (automatic): SUBNAME: LYASE AMMONIA-LYASE FULL=DIAMINOPROPIONATE FULL=PUTATIVE EC=4.3.1.15 DEHYDRATASE UNCHARACTERIZED ALTNAME: EC=4.3.1.19 Length = 90 Score = 159 (65.9 bits), Expect = 1e-10 Identities = 31/88 (35%), Positives = 50/88 (56%), Gaps = 1/88 (1%)
 Query:     98 VVAASAGNHAQGLARHAELLGIRATIVMPAQTPSVKVEETKRFGAEVILHGTDFEAAHAE 157
               V AASAGNHA  L+ H + LG+   +VMP   P +K+   +  GA++++ G D   +   
 Sbjct:    149 VFAASAGNHALALSLHGKQLGVEVNVVMPKIAPLMKINRCQELGAKILVEGNDIAESREI 208

 Query:    158 AIRQVEEEGKTLVHPFDDPYVAAGQGTI 185
               A+R   E+  T ++ +D   + AG GT+
 Sbjct:    209 ALRMAYEQKGTYINGYDHYDILAGAGTV 236

>PDC66453 (Closest domain: THDH_SCHPO 200-253) Number of domains in family: 110 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT FULL=PUTATIVE AMMONIA-LYASE Length = 54 Score = 157 (65.1 bits), Expect = 1e-10 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Query:    138 KRFGAEVILHGTDFEAAHAEAIRQVEEEGKTLVHPFDDPYVAAGQGTIA 186
               KR GA V+LHG +F+ A AE  R  +E+   ++HPFDDPYV AGQGTI 
 Sbjct:    204 KRLGANVLLHGANFDIAKAECARLAKEQNLEVIHPFDDPYVIAGQGTIG 252

>PD879289 (Closest domain: E0THN2_PARBH 250-283) Number of domains in family: 505 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT FULL=PUTATIVE AMMONIA-LYASE Length = 34 Score = 156 (64.7 bits), Expect = 1e-10 Identities = 31/31 (100%), Positives = 31/31 (100%), Gaps = 1/31 (3%)
 Query:    250 MTLAEGIAVCDPGRFTREVVARLVDEIVTVD 280
               MTLAEGIAVCDPGRFTREVVARLVDEIVTVD
 Sbjct:    250 MTLAEGIAVCDPGRFTREVVARLVDEIVTVD 280

>PD827414 (Closest domain: E0THN2_PARBH 307-340) Number of domains in family: 1184 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 AMMONIA-LYASE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA SUBUNIT FULL=L-THREONINE Length = 34 Score = 148 (61.6 bits), Expect = 1e-09 Identities = 27/27 (100%), Positives = 27/27 (100%), Gaps = 5/27 (18%)
 Query:    313 HPHLFEGHAVGTIVCGGNIDPRLLSSI 339
               HPHLFEGHAVGTIVCGGNIDPRLLSSI
 Sbjct:    313 HPHLFEGHAVGTIVCGGNIDPRLLSSI 339

>PDB5H8I3 (Closest domain: D5VPW1_CAUST 70-114) Number of domains in family: 262 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 FULL=PUTATIVE BETA FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT SUBUNIT AMMONIA-LYASE Length = 45 Score = 145 (60.5 bits), Expect = 4e-09 Identities = 29/44 (65%), Positives = 33/44 (75%), Gaps = 5/44 (11%)
 Query:     97 GVVAASAGNHAQGLARHAELLGIRATIVMPAQTPSVKVEETKRF 140
               GV+AASAGNHAQGLA H   LG+  TIVMP  TP VKV+ T+ F
 Sbjct:     71 GVIAASAGNHAQGLAYHGARLGVPVTIVMPKTTPFVKVQHTRDF 114

>PDA026V7 (Closest domain: D6JXQ7_ACIG3 124-171) Number of domains in family: 680 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA SUBUNIT FULL=PUTATIVE AMMONIA-LYASE Length = 48 Score = 141 (58.9 bits), Expect = 2e-08 Identities = 29/48 (60%), Positives = 33/48 (68%), Gaps = 3/48 (6%)
 Query:    142 AEVILHGTDFEAAHAEAIRQVEEEGKTLVHPFDDPYVAAGQGTIAKEM 189
               A VILHG DF  A AE  R  +EE  T++HPFDD  + AGQGTIA EM
 Sbjct:    124 ARVILHGQDFSEAAAEMHRVAQEESLTIIHPFDDTEIIAGQGTIALEM 171

>PDA857O4 (Closest domain: E1V5I0_HALED 224-308) Number of domains in family: 91 Commentary (automatic): SUBNAME: LYASE DEHYDRATASE BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT FULL=PUTATIVE FULL=THREONINE EC=4.3.1.19 THREONINE Length = 85 Score = 134 (56.2 bits), Expect = 3e-07 Identities = 31/82 (37%), Positives = 37/82 (45%), Gaps = 1/82 (1%)
 Query:    251 TLAEGIAVCDPGRFTREVVARLVDEIVTVDXXXXXXXXXXXXMTQKTXXXXXXXXXXXXX 310
               TLAEGIAV  PG  TRE+V  LV +I  VD              +KT             
 Sbjct:    225 TLAEGIAVKQPGELTRELVRELVSDITLVDEPEIERAILMLLEIEKTVAEGAGAAGLAAL 284

 Query:    311 XXHPHLFEGHAVGTIVCGGNID 332
                  P  + G  VG ++CGGNID
 Sbjct:    285 LTEPERYRGRKVGLVLCGGNID 306

>PDC657H6 (Closest domain: B3PGI4_CELJU 157-199) Number of domains in family: 135 Commentary (automatic): SUBNAME: FULL=THREONINE LYASE EC=4.3.1.19 DEHYDRATASE AMMONIA-LYASE FULL=L-THREONINE BIOSYNTHETIC EC=4.3.1.17 DEHYDRATASE Length = 43 Score = 129 (54.3 bits), Expect = 6e-07 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 2/43 (4%)
 Query:    141 GAEVILHGTDFEAAHAEAIRQVEEEGKTLVHPFDDPYVAAGQG 183
               GA+V+LHG  ++ A A A + VEE+G T +HPFDDP V AGQG
 Sbjct:    157 GAKVVLHGDSYDEASAHAKKLVEEKGLTYIHPFDDPDVIAGQG 199

>PD482214 (Closest domain: E0THN2_PARBH 190-231) Number of domains in family: 1906 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC AMMONIA-LYASE FULL=PUTATIVE DEHYDRATASE FULL=L-THREONINE Length = 42 Score = 125 (52.8 bits), Expect = 2e-06 Identities = 28/42 (66%), Positives = 28/42 (66%), Gaps = 2/42 (4%)
 Query:    190 LCEAPEIDTLVXXXXXXXXXXXXXXVAKEMRPDIRIIGVQAA 231
               LCEAPEIDTLV              VAKEMRPDIRIIGVQAA
 Sbjct:    190 LCEAPEIDTLVIPIGGGGLIAGMAAVAKEMRPDIRIIGVQAA 231

>PDB3L707 (Closest domain: D8HM05_AMYMU 73-119) Number of domains in family: 12 Commentary (automatic): SUBNAME: SCAFFOLD BIOSYNTHESIS FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT REFERENCE FULL=PUTATIVE UNCHARACTERIZED BETA SUBUNIT CYSTEINE Length = 47 Score = 125 (52.8 bits), Expect = 3e-06 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Query:     98 VVAASAGNHAQGLARHAELLGIRATIVMPAQTPSVKVEETKRFGAEV 144
               VVAASAGNHAQG+A  + LLG ++T+ MP + P  K+  T+ +GA+V
 Sbjct:     73 VVAASAGNHAQGVALASSLLGAKSTVFMPLRAPLPKLAATRGYGADV 119

>PDC7L8T4 (Closest domain: F4X1E5_ACREC 163-319) Number of domains in family: 8 Commentary (automatic): SUBNAME: SYNTHETASE AMINOACYL-TRNA FULL=PUTATIVE UNCHARACTERIZED NUCLEOTIDE-BINDING FULL=BIFUNCTIONAL ATP-BINDING LIGASE BIOSYNTHESIS Length = 157 Score = 120 (50.8 bits), Expect = 3e-05 Identities = 34/116 (29%), Positives = 59/116 (50%), Gaps = 1/116 (0%)
 Query:     86 LLSLSDAERQSGVVAASAGNHAQGLARHAELLGIRATIVMPAQTPSVKVEETKRF-GAEV 144
               LL LS+ ++  GVV  S+G+ A  +  +A    I  T+VMP+ T   K+E  + +  A V
 Sbjct:    165 LLHLSEEQKCKGVVTISSGSFAFTICHYAHHNEIPVTVVMPSTTAKEKIEMCQGYLLARV 224

 Query:    145 ILHGTDFEAAHAEAIRQVEEEGKTLVHPFDDPYVAAGQGTIAKEMLCEAPEIDTLV 200
               ++ G +   AH  A+     E    +   D P +  GQ T+  E++ +  +ID ++
 Sbjct:    225 LVRGNNLLEAHRAALDIAMREDLFYLDGNDHPNMIIGQATLGIEIMQQQSKIDVVL 280

>PDA210O4 (Closest domain: B9LBZ4_CHLSY 73-122) Number of domains in family: 232 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=PUTATIVE FULL=L-SERINE LYASE UNCHARACTERIZED EC=4.3.1.19 EC=4.3.1.17 BETA FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT Length = 50 Score = 114 (48.5 bits), Expect = 6e-05 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 2/50 (4%)
 Query:     98 VVAASAGNHAQGLARHAELLGIRATIVMPAQTPSVKVEETKRFGAEVILH 147
               VVA SAGNHA G+A  A L G  AT+V+P      KV   +R+  EVILH
 Sbjct:     73 VVACSAGNHALGVAHTAALTGTPATLVVPTTASPAKVTALRRYPVEVILH 122

>PDC677U8 (Closest domain: F6AUL4_DELSC 146-175) Number of domains in family: 81 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC DEHYDRATASE THREONINE FULL=PUTATIVE ILVA Length = 30 Score = 111 (47.4 bits), Expect = 0.0002 Identities = 20/25 (80%), Positives = 21/25 (84%), Gaps = 5/25 (20%)
 Query:    168 TLVHPFDDPYVAAGQGTIAKEMLCE 192
               T VHPFDDPYV AGQGTIA EML +
 Sbjct:    146 TFVHPFDDPYVIAGQGTIAMEMLSQ 170

>PD387799 (Closest domain: C7L1R7_ACEPA 326-391) Number of domains in family: 477 Commentary (automatic): SUBNAME: KINASE FULL=GTP TRANSFERASE EC=2.7.6.5 PYROPHOSPHOKINASE SYNTHETASE FULL=PPPGPP SPOT/RELA I Length = 66 Score = 108 (46.2 bits), Expect = 0.0005 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 1/58 (1%)
 Query:    359 DVPGQLTRVSAAIGAAGGNVIDVSYHKVFNDLPAKQTHLDISVEATGPAHMDRIVEAL 416
               D PG L  +S +IG AGGN+I+VS+ ++F     +   L++ +EA  P H   I + L
 Sbjct:    332 DRPGVLADISKSIGEAGGNIIEVSHQRLFAAPSVQAAQLEVMIEARDPEHAALITQEL 389

>PDB1O9V8 (Closest domain: B2JCU4_BURP8 146-204) Number of domains in family: 22 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE REFERENCE FULL=PUTATIVE UNCHARACTERIZED SHOTGUN LYASE GENOME SEQUENCE Length = 59 Score = 107 (45.8 bits), Expect = 0.0008 Identities = 25/60 (41%), Positives = 33/60 (55%), Gaps = 3/60 (5%)
 Query:    169 LVHPFDDPYVAAGQGTIAKEMLC--EAPEIDTLVXXXXXXXXXXXXXXVAKEMRPDIRII 226
                VHPFDDPYV AGQGT+A E+L   +AP I  +                 K +RP+I++I
 Sbjct:    146 FVHPFDDPYVIAGQGTVAMEVLSQHQAP-IHAIFVPIGGGGLAAGIAAYVKSVRPEIKVI 204

>PD869428 (Closest domain: C7YTU4_NECH7 12-70) Number of domains in family: 289 Commentary (automatic): SUBNAME: SYNTHASE FULL=THREONINE LYASE FULL=L-SERINE DEHYDRATASE FULL=PUTATIVE EC=4.2.3.1 EC=4.3.1.17 UNCHARACTERIZED Length = 59 Score = 102 (43.9 bits), Expect = 0.003 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 7/35 (20%)
 Query:     47 ETPCLPSRKLGALTNCRLWLKYENLQYIGAFKERG 81
               +TPC+PS +L  +  C ++LK ENLQ  G+FK RG
 Sbjct:     14 KTPCIPSPQLSKVAGCNVYLKLENLQPSGSFKSRG 48

>PD925716 (Closest domain: G0EDR1_PYRF1 56-119) Number of domains in family: 3520 Commentary (automatic): BIOSYNTHESIS SYNTHASE FULL=CYSTEINE EC=2.5.1.47 TRANSFERASE RECNAME: CYSTEINE AMINO-ACID SUBNAME: LYASE Length = 64 Score = 99 (42.7 bits), Expect = 0.008 Identities = 23/47 (48%), Positives = 31/47 (65%), Gaps = 2/47 (4%)
 Query:     98 VVAASAGNHAQGLARHAELLGIRATIVMPAQTPSVKVEETKRFGAEV 144
               VV AS+GN A  +A  A LLG+RA I++P  T SVK+   +  GA+V
 Sbjct:     71 VVEASSGNTAVSVAWVARLLGLRAVIIVPRTTSSVKIGLLQALGADV 117