Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PD526846 score=251 PD786156 score=227 PDA2K3G9 score=198 PDC657H6 score=206 PD414066 score=230 PDA857M8 score=198 PDA857O4 score=198 PDA9T8H7 score=275 PD827414 score=189 PDA1F5E7 score=393


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PDA1F5E7
PDA9T8H7
PD526846
PD414066
PD786156
PDC657H6
PDA857O4
PDA857M8
PDA2K3G9
PD827414
PDA1V4U2
PD900101
PDC66453
PD482214
PDD351N1
PDA026V7
PDB5H8I3
PD879289
PDC677U8
PDB2L4E9
PDB0D1K9
PDC7L8T4
PDB3L707
PD387799
PDC650L5
PDD08952
PDA210O4
PDB0H2L1
PDC653O7
PD925716

Domain 3D modelling using Swiss-Model

Domain IDBEGINEND 
PD526846
PD414066
PD786156
PDA2K3G9
PDA1V4U2
PDB5H8I3

Domain 3D modelling using Geno3D

Domain IDBEGINEND 
PD526846
PD414066
PD786156
PDA2K3G9
PDA1V4U2
PDB5H8I3


HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(403 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

      1-54  #PD526846                                            251 6e-24
    14-176  #PDD351N1                                            156 3e-09
     37-65  #PDC653O7                                            102 0.002
    39-102  #PD786156                                            227 1e-20
    59-149  #PDC7L8T4                                            124 6e-06
    62-114  #PDB5H8I3                                            150 9e-10
     70-99  #PDC650L5                                            107 0.0004
    71-137  #PDA1V4U2                                            181 6e-14
    71-149  #PDB0H2L1                                            103 0.003
    71-118  #PD925716                                            100 0.005
    71-132  #PDA210O4                                            104 0.002
    71-117  #PDB3L707                                            124 2e-06
   100-161  #PDA2K3G9                                            198 2e-16
   106-160  #PDC66453                                            162 2e-11
   106-214  #PDA857M8                                            198 8e-16
   114-155  #PDC657H6                                            206 1e-17
   115-162  #PDA026V7                                            155 2e-10
   119-164  #PD414066                                            230 4e-21
   142-198  #PDC677U8                                            129 7e-07
   151-307  #PDB2L4E9                                            127 1e-05
   162-212  #PD482214                                            157 1e-10
   212-264  #PDA857O4                                            198 2e-16
   222-268  #PD900101                                            166 4e-12
   225-259  #PD879289                                            129 6e-07
   226-254  #PDB0D1K9                                            124 2e-06
   247-308  #PDA9T8H7                                            275 3e-27
   256-308  #PDD08952                                            107 0.0006
   267-311  #PD827414                                            189 3e-15
   314-399  #PDA1F5E7                                            393 1e-43
   329-396  #PD387799                                            116 4e-05


>PDA1F5E7 (Closest domain: A1VZH2_CAMJJ 314-399)
Number of domains in family: 442
Commentary (automatic):
SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 AMMONIA-LYASE FULL=L-THREONINE REFERENCE FULL=PUTATIVE THREONINE  
Length = 86
Score = 393  (156.0 bits), Expect = 1e-43
Identities = 74/86 (86%), Positives = 81/86 (94%)

 Query:    314 IIIEKGLFKAYRKMQINVTLIDKPGSLLNLTDSLKSANANIVKIDYDRFSTKLDYGDAMI 373
               IIIEKGLFK+YRKMQI+VTL+DKPG+LL+LTDSLK ANANIVKIDYDRFSTKLDYGDAMI
 Sbjct:    314 IIIEKGLFKSYRKMQIHVTLVDKPGALLHLTDSLKIANANIVKIDYDRFSTKLDYGDAMI 373

 Query:    374 SITLETKGKEHQEEVRNILKDKGFDF 399
               SITLETKGKEHQEE+R IL  K F+F
 Sbjct:    374 SITLETKGKEHQEEIRKILTQKAFNF 399

>PDA9T8H7 (Closest domain: D3FM48_CAMJI 247-308) Number of domains in family: 658 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC DEHYDRATASE AMMONIA-LYASE FULL=L-THREONINE DEAMINASE Length = 62 Score = 275 (110.5 bits), Expect = 3e-27 Identities = 54/62 (87%), Positives = 60/62 (96%)
 Query:    247 CVNEFVQVDDEEIANAVLFLLEKHKIIVEGAGAASVAALLHQKIDIKDSKKIGVVLSGGN 306
               CV++F+QVDDEEIANAVLFLLEKHKIIVEGAGAASVAALLHQKI+ ++ KKIGVVLSGGN
 Sbjct:    247 CVDDFIQVDDEEIANAVLFLLEKHKIIVEGAGAASVAALLHQKINTQNHKKIGVVLSGGN 306

 Query:    307 ID 308
               ID
 Sbjct:    307 ID 308

>PD526846 (Closest domain: A7H425_CAMJD 1-54) Number of domains in family: 939 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 AMMONIA-LYASE FULL=L-THREONINE CATABOLIC THREONINE BETA Length = 54 Score = 251 (101.3 bits), Expect = 6e-24 Identities = 45/54 (83%), Positives = 53/54 (98%)
 Query:      1 MLELNKIYQAKQKIADFVSKTPFIHSSFLSELCKSEVYLKNENLQITGAYKIRG 54
               MLELNKIY+AKQ+I+ FV+KTPFIHSSFLS++C+SE+YLKNENLQITGAYKIRG
 Sbjct:      1 MLELNKIYKAKQQISGFVNKTPFIHSSFLSDICQSEIYLKNENLQITGAYKIRG 54

>PD414066 (Closest domain: A1VZH2_CAMJJ 119-164) Number of domains in family: 1521 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC AMMONIA-LYASE FULL=L-THREONINE DEHYDRATASE DEAMINASE Length = 46 Score = 230 (93.2 bits), Expect = 4e-21 Identities = 43/46 (93%), Positives = 44/46 (95%)
 Query:    119 LKGDNFDEAYAFATNYAKENGLSFIHPFEDELVMAGQGTLMLEMLD 164
               LKGDNFDEAYAFAT+YAKEN LSFIHPFEDE VMAGQGTLMLEMLD
 Sbjct:    119 LKGDNFDEAYAFATSYAKENNLSFIHPFEDEFVMAGQGTLMLEMLD 164

>PD786156 (Closest domain: A5TSK4_FUSNP 39-102) Number of domains in family: 1947 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC DEHYDRATASE AMMONIA-LYASE THREONINE FULL=L-THREONINE Length = 64 Score = 227 (92.0 bits), Expect = 1e-20 Identities = 46/64 (71%), Positives = 52/64 (81%)
 Query:     39 LKNENLQITGAYKIRGAYNKIANLDPEAKKAGVIAASAGNHAQGVAISAKKFDTKAIIVM 98
               LK ENLQ TG++KIRGAYNKIA L  E KK GVIA+SAGNHAQGVA +AKK   KA+IVM
 Sbjct:     39 LKPENLQKTGSFKIRGAYNKIAKLSDEEKKKGVIASSAGNHAQGVAYAAKKLGIKAVIVM 98

 Query:     99 PEST 102
               P+ T
 Sbjct:     99 PQHT 102

>PDC657H6 (Closest domain: Q0PA62_CAMJE 114-155) Number of domains in family: 135 Commentary (automatic): SUBNAME: FULL=THREONINE LYASE EC=4.3.1.19 DEHYDRATASE AMMONIA-LYASE FULL=L-THREONINE BIOSYNTHETIC EC=4.3.1.17 DEHYDRATASE Length = 42 Score = 206 (84.0 bits), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%)
 Query:    114 GAEVILKGDNFDEAYAFATNYAKENGLSFIHPFEDELVMAGQ 155
               GAEVIL+GDNFDEAYAFAT+YAKEN LSFIHPFEDE VMAGQ
 Sbjct:    114 GAEVILRGDNFDEAYAFATSYAKENNLSFIHPFEDEFVMAGQ 155

>PDA857O4 (Closest domain: A7I331_CAMHC 346-398) Number of domains in family: 91 Commentary (automatic): SUBNAME: LYASE DEHYDRATASE BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT FULL=PUTATIVE FULL=THREONINE EC=4.3.1.19 THREONINE Length = 53 Score = 198 (80.9 bits), Expect = 2e-16 Identities = 42/53 (79%), Positives = 46/53 (86%), Gaps = 1/53 (1%)
 Query:    212 SFKAKEVKNSKSVRTIADGIAVRDANPINLGIILECVNEFVQVDDEEIANAVL 264
               SF AK+V NSKSVRTIADGIAVRDA+ I L IILE V+EFVQVDD EIANA+L
 Sbjct:    346 SFLAKKVINSKSVRTIADGIAVRDASEITLKIILETVDEFVQVDDNEIANAIL 398

>PDA857M8 (Closest domain: D1C1H4_SPHTD 113-225) Number of domains in family: 57 Commentary (automatic): SUBNAME: BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT LYASE FULL=THREONINE FULL=PUTATIVE EC=4.3.1.19 DEHYDRATASE UNCHARACTERIZED Length = 113 Score = 198 (80.9 bits), Expect = 8e-16 Identities = 40/109 (36%), Positives = 65/109 (59%), Gaps = 1/109 (0%)
 Query:    106 KVSATKSLGAEVILKGDNFDEAYAFATNYAKENGLSFIHPFEDELVMAGQGTLMLEMLDD 165
               KV++ + LGAEV+L G +FDEA   A   A+ +G+ +IH   +  ++AG GT  LEM++ 
 Sbjct:    116 KVASMRRLGAEVVLTGRDFDEARLAAEERAERDGMRYIHSANEPDLIAGVGTYALEMIEA 175

 Query:    166 VSDLDTIIAPVXXXXXXXXXXXXXKQINPNIKIIAVGAKGAPAMHDSFK 214
               V DLDT+I PV             K +NP I++I V ++  P ++ +++
 Sbjct:    176 VPDLDTVIVPVGAGSGVCGTAIVMKAVNPAIRVIGVQSEEMPVVYRAWR 224

>PDA2K3G9 (Closest domain: F2JGM5_CELLD 106-167) Number of domains in family: 166 Commentary (automatic): SUBNAME: LYASE AMMONIA-LYASE FULL=DIAMINOPROPIONATE FULL=PUTATIVE EC=4.3.1.15 DEHYDRATASE UNCHARACTERIZED ALTNAME: EC=4.3.1.19 Length = 62 Score = 198 (80.9 bits), Expect = 2e-16 Identities = 37/62 (59%), Positives = 46/62 (74%), Gaps = 1/62 (1%)
 Query:    100 ESTPLLKVSATKSLGAEVILKGDNFDEAYAFATNYAKENGLSFIHPFEDELVMAGQGTLM 159
               E+TPL+KV ATK+ GA V+L G  +DEAY  A    +ENG +FIHPF D+ VMAGQGT+ 
 Sbjct:    106 ETTPLIKVQATKNWGAHVVLAGQVYDEAYETAKKLEQENGYTFIHPFNDKEVMAGQGTIA 165

 Query:    160 LE 161
               LE
 Sbjct:    166 LE 167

>PD827414 (Closest domain: A1VZH2_CAMJJ 267-311) Number of domains in family: 1184 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 AMMONIA-LYASE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA SUBUNIT FULL=L-THREONINE Length = 45 Score = 189 (77.4 bits), Expect = 3e-15 Identities = 38/45 (84%), Positives = 41/45 (91%), Gaps = 1/45 (2%)
 Query:    267 LEKHKIIVEGAGAASVAALLHQKIDIKDSKKIGVVLSGGNIDVQM 311
               LEKHKIIVEGAGAASVA LLHQKI+ ++ KKIGVVLSGGNID QM
 Sbjct:    267 LEKHKIIVEGAGAASVATLLHQKINTQNHKKIGVVLSGGNIDAQM 311

>PDA1V4U2 (Closest domain: A8MDC1_CALMQ 86-152) Number of domains in family: 465 Commentary (automatic): SUBNAME: LYASE AMMONIA-LYASE FULL=DIAMINOPROPIONATE EC=4.3.1.15 FULL=PUTATIVE FULL=THREONINE SYNTHASE DEHYDRATASE EC=4.3.1.19 Length = 67 Score = 181 (74.3 bits), Expect = 6e-14 Identities = 36/67 (53%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Query:     71 VIAASAGNHAQGVAISAKKFDTKAIIVMPESTPLLKVSATKSLGAEVILKGDNFDEAYAF 130
               V+ ASAGNHAQGVA  AK +  K+ IVMP+ TP +K+S T+  GAEVIL+G ++ EA  +
 Sbjct:     86 VVTASAGNHAQGVAYVAKIYGLKSTIVMPKYTPWIKISNTRKYGAEVILEGQSYYEAEKY 145

 Query:    131 ATNYAKE 137
               A    KE
 Sbjct:    146 AIELTKE 152

>PD900101 (Closest domain: Q7VHR7_HELHP 225-273) Number of domains in family: 68 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE FULL=PUTATIVE REFERENCE UNCHARACTERIZED EC=4.3.1.19 LYASE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA Length = 49 Score = 166 (68.6 bits), Expect = 4e-12 Identities = 32/47 (68%), Positives = 39/47 (82%), Gaps = 2/47 (4%)
 Query:    222 KSVRTIADGIAVRDANPINLGIILECVNEFVQVDDEEIANAVLFLLE 268
               +SVR+IADGIAVRD N  N  ++ ECV+E V VDDEEIANA+LFL+E
 Sbjct:    227 ESVRSIADGIAVRDVNEENFALVQECVDEIVSVDDEEIANAILFLIE 273

>PDC66453 (Closest domain: Q890M3_CLOTE 108-163) Number of domains in family: 110 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT FULL=PUTATIVE AMMONIA-LYASE Length = 56 Score = 162 (67.0 bits), Expect = 2e-11 Identities = 32/55 (58%), Positives = 40/55 (72%), Gaps = 2/55 (3%)
 Query:    106 KVSATKSLGAEVILKGDNFDEAYAFATNYAKENGLSFIHPFEDELVMAGQGTLML 160
               KV+ATK  GA+VI  G+ +DE Y  A    KENG +FIHPF+DE V+AGQGT+ L
 Sbjct:    109 KVNATKGYGAKVIQCGEVYDECYIKALQTQKENGYTFIHPFDDEQVIAGQGTIGL 163

>PD482214 (Closest domain: Q5HUW8_CAMJR 162-212) Number of domains in family: 1906 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC AMMONIA-LYASE FULL=PUTATIVE DEHYDRATASE FULL=L-THREONINE Length = 51 Score = 157 (65.1 bits), Expect = 1e-10 Identities = 32/51 (62%), Positives = 36/51 (70%), Gaps = 2/51 (3%)
 Query:    162 MLDDVSDLDTIIAPVXXXXXXXXXXXXXKQINPNIKIIAVGAKGAPAMHDS 212
               MLD++SDLD IIAPV             KQINPNIKII VGAKGAPAM++S
 Sbjct:    162 MLDEISDLDMIIAPVGGGGLISGIASAAKQINPNIKIIGVGAKGAPAMYES 212

>PDD351N1 (Closest domain: F4Q8I7_DICFS 65-355) Number of domains in family: 2 Commentary (automatic): FULL=THREONINE SUBNAME: LYASE AMMONIA-LYASE Length = 291 Score = 156 (64.7 bits), Expect = 3e-09 Identities = 49/183 (26%), Positives = 84/183 (45%), Gaps = 20/183 (10%)
 Query:     14 IADFVSKTPFIHSSFLSELCKSEVYLKNENLQITGAYKIRGA--------YNKIANLDPE 65
               ++ ++ KTP +H   LS+L K  V LK ENLQ+ G   +R          +N+++ +  E
 Sbjct:    137 VSTYLKKTPQLHYELLSQLFKCNVQLKLENLQLFGDVYVRNCFSVLIGNYFNQVSTIKKE 196

 Query:     66 AKKAGVIAASAGNHA-------QGVAISAKKFDTKAII-VMPESTPLLKV---SATKSLG 114
                ++ G   +              G+ ++A     K II V P    +L+V       + G
 Sbjct:    197 LREVGGYVSVMDPDKFDLQATFAGIVLTAIHLKMKFIIYVAPGKLNILQVVQLYMCHARG 256

 Query:    115 AEVILKGDNFDEAYAFATNYAKENGLSFI-HPFEDELVMAGQGTLMLEMLDDVSDLDTII 173
               A++I    +    Y  A  +A +  + F+   F  +  + G GTL  EM++D +D D II
 Sbjct:    257 AKIIFHKGDTQTCYQRAKQHANDLHMVFVDMKFNPQFSLIGAGTLASEMMEDCNDRDAII 316

 Query:    174 APV 176
                P+
 Sbjct:    317 IPL 319

>PDA026V7 (Closest domain: Q74FW6_GEOSL 115-162) Number of domains in family: 680 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA SUBUNIT FULL=PUTATIVE AMMONIA-LYASE Length = 48 Score = 155 (64.3 bits), Expect = 2e-10 Identities = 30/48 (62%), Positives = 36/48 (75%), Gaps = 3/48 (6%)
 Query:    115 AEVILKGDNFDEAYAFATNYAKENGLSFIHPFEDELVMAGQGTLMLEM 162
               AEV+L G NFDEAYA A    +E G  F+HPF+D LVMAGQGT+ LE+
 Sbjct:    115 AEVVLTGRNFDEAYAAAVQAQEERGALFVHPFDDPLVMAGQGTIGLEV 162

>PDB5H8I3 (Closest domain: G4Q3Q6_ACIIR 64-118) Number of domains in family: 262 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 FULL=PUTATIVE BETA FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT SUBUNIT AMMONIA-LYASE Length = 55 Score = 150 (62.4 bits), Expect = 9e-10 Identities = 30/53 (56%), Positives = 37/53 (69%), Gaps = 1/53 (1%)
 Query:     62 LDPEAKKAGVIAASAGNHAQGVAISAKKFDTKAIIVMPESTPLLKVSATKSLG 114
               L PE K+ G+IAASAGNHAQGVA+       ++ +VMPE+ PL KV ATK  G
 Sbjct:     66 LSPEQKERGIIAASAGNHAQGVALGGTMNAIRSTVVMPEAAPLAKVQATKGYG 118

>PD879289 (Closest domain: A7ZDV2_CAMC1 225-259) Number of domains in family: 505 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT FULL=PUTATIVE AMMONIA-LYASE Length = 35 Score = 129 (54.3 bits), Expect = 6e-07 Identities = 28/35 (80%), Positives = 31/35 (88%), Gaps = 1/35 (2%)
 Query:    225 RTIADGIAVRDANPINLGIILECVNEFVQVDDEEI 259
               RTIADGIAVRDA+ I L  I+ECV+EFVQVDDEEI
 Sbjct:    225 RTIADGIAVRDASEITLKNIVECVDEFVQVDDEEI 259

>PDC677U8 (Closest domain: F0ZWJ2_DICPU 150-207) Number of domains in family: 81 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC DEHYDRATASE THREONINE FULL=PUTATIVE ILVA Length = 58 Score = 129 (54.3 bits), Expect = 7e-07 Identities = 27/57 (47%), Positives = 33/57 (57%), Gaps = 1/57 (1%)
 Query:    142 FIHPFEDELVMAGQGTLMLEMLDDVSDLDTIIAPVXXXXXXXXXXXXXKQINPNIKI 198
                IHPF +  V+AGQGT  LE+L+ V DLD +I PV             K INPNIK+
 Sbjct:    150 LIHPFNNLDVIAGQGTAALELLEQVKDLDAVITPVGGGGLLSGTLISVKSINPNIKV 206

>PDB2L4E9 (Closest domain: Q2KEE1_MAGO7 265-509) Number of domains in family: 5 Commentary (automatic): SUBNAME: DEPENDENT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA SUBUNIT ENZYME PYRIDOXAL-PHOSPHATE FULL=PUTATIVE UNCHARACTERIZED FULL=SIMILAR Length = 245 Score = 127 (53.5 bits), Expect = 1e-05 Identities = 46/166 (27%), Positives = 77/166 (46%), Gaps = 14/166 (8%)
 Query:    151 VMAGQGTLMLEMLDDVSDLDTIIAPVXXXXXXXXXXXXXKQINPNIKIIAVGAKGAPAMH 210
               V AG GT+MLE  +D    DT++ P+                +P   ++    +      
 Sbjct:    270 VTAGAGTVMLEAEEDHGVFDTVVVPLGGGGLAAGVGAWCAHNSPRTNVVCTHPE---IFG 326

 Query:    211 DSFKAKEVKNSKSVRTIA----DGIAVRDANPINLGIIL-ECVNEFVQVDDEEIANAVLF 265
                 F   E   S+ V   A    DG+AV+ A       IL E + + VQV + E A A+  
 Sbjct:    327 RKFAKSEPIASQLVSPTAVSYSDGLAVQLARETPFARILQETIRDVVQVTEAETAVAISI 386

 Query:    266 LLEKHKIIVEGAGAASVAALLHQKIDIKDSK----KIGVVLSGGNI 307
                L    +++EG+ A ++AALL  K +  +++    ++ ++L+GGNI
 Sbjct:    387 ALRMQSLLIEGSAATTIAALL--KPEAPETRHIKGRVLLLLTGGNI 430

>PDB0D1K9 (Closest domain: A1VZH2_CAMJJ 226-254) Number of domains in family: 538 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC AMMONIA-LYASE DEAMINASE FULL=L-THREONINE DEHYDRATASE Length = 29 Score = 124 (52.4 bits), Expect = 2e-06 Identities = 24/29 (82%), Positives = 27/29 (93%), Gaps = 3/29 (10%)
 Query:    226 TIADGIAVRDANPINLGIILECVNEFVQV 254
               TIADGIAVRDANPIN  IILECV++F+QV
 Sbjct:    226 TIADGIAVRDANPINFNIILECVDDFIQV 254

>PDC7L8T4 (Closest domain: F4X1E4_ACREC 382-476) Number of domains in family: 8 Commentary (automatic): SUBNAME: SYNTHETASE AMINOACYL-TRNA FULL=PUTATIVE UNCHARACTERIZED NUCLEOTIDE-BINDING FULL=BIFUNCTIONAL ATP-BINDING LIGASE BIOSYNTHESIS Length = 95 Score = 124 (52.4 bits), Expect = 6e-06 Identities = 31/91 (34%), Positives = 46/91 (50%), Gaps = 1/91 (1%)
 Query:     59 IANLDPEAKKAGVIAASAGNHAQGVAISAKKFDTKAIIVMPESTPLLKVSATKSLGAEVI 118
               +  L  + K+ GVIA S G  AQ +    +KF     +VM +ST    V   + LGA VI
 Sbjct:    384 LLQLTNKQKRNGVIAISTGYFAQTLCYFGQKFRVPVTVVMQKSTAQEIVDKCQYLGATVI 443

 Query:    119 LKGDNFDEAYAFATNYAKENGLSFIHPFEDE 149
                +GDN  E +  A   A+  GL ++   ++E
 Sbjct:    444 AQGDNIIEVHNIALQIARTKGLCYLDGMDEE 474

>PDB3L707 (Closest domain: D8HM05_AMYMU 73-119) Number of domains in family: 12 Commentary (automatic): SUBNAME: SCAFFOLD BIOSYNTHESIS FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT REFERENCE FULL=PUTATIVE UNCHARACTERIZED BETA SUBUNIT CYSTEINE Length = 47 Score = 124 (52.4 bits), Expect = 2e-06 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 8/47 (17%)
 Query:     71 VIAASAGNHAQGVAISAKKFDTKAIIVMPESTPLLKVSATKSLGAEV 117
               V+AASAGNHAQGVA+++     K+ + MP   PL K++AT+  GA+V
 Sbjct:     73 VVAASAGNHAQGVALASSLLGAKSTVFMPLRAPLPKLAATRGYGADV 119

>PD387799 (Closest domain: B2V388_CLOBA 325-393) Number of domains in family: 477 Commentary (automatic): SUBNAME: KINASE FULL=GTP TRANSFERASE EC=2.7.6.5 PYROPHOSPHOKINASE SYNTHETASE FULL=PPPGPP SPOT/RELA I Length = 69 Score = 116 (49.3 bits), Expect = 4e-05 Identities = 24/68 (35%), Positives = 40/68 (58%), Gaps = 1/68 (1%)
 Query:    329 INVTLIDKPGSLLNLTDSLKSANANIVKIDYDRFSTKLDYGDAMISITLETKGKEHQEEV 388
               ++V L DKPG L N++  +  A  NI+++D+++F +        + IT+ET G EH+  +
 Sbjct:    326 LSVLLPDKPGELTNVSKVIAEAQGNIIRLDHNQFVSINRNSAVELKITMETFGPEHKNSI 385

 Query:    389 RNILKDKG 396
                  LKD G
 Sbjct:    386 IKALKDNG 393

>PDC650L5 (Closest domain: ILVA_STAEQ 73-106) Number of domains in family: 178 Commentary (automatic): SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC FULL=L-THREONINE BIOSYNTHESIS AMMONIA-LYASE ILVA Length = 34 Score = 107 (45.8 bits), Expect = 0.0004 Identities = 20/30 (66%), Positives = 24/30 (80%), Gaps = 1/30 (3%)
 Query:     70 GVIAASAGNHAQGVAISAKKFDTKAIIVMP 99
               G+  ASAGNHAQGVA +AKK + KA+I MP
 Sbjct:     75 GITCASAGNHAQGVAYTAKKLNLKAVIFMP 104

>PDD08952 (Closest domain: Q975Y3_SULTO 257-309) Number of domains in family: 3 Commentary (automatic): FULL=THREONINE SUBNAME: DEHYDRATASE EC=4.3.1.19 LYASE Length = 53 Score = 107 (45.8 bits), Expect = 0.0006 Identities = 33/53 (62%), Positives = 42/53 (79%), Gaps = 1/53 (1%)
 Query:    256 DEEIANAVLFLLEKHKIIVEGAGAASVAALLHQKIDIKDSKKIGVVLSGGNID 308
               DEEIANA+++LLE++K +VEGA AAS+AALL  KI +  + K   VLSGGNID
 Sbjct:    257 DEEIANAIVYLLERNKTLVEGAAAASLAALLSGKIKVAYNHKAIPVLSGGNID 309

>PDA210O4 (Closest domain: C5M9S1_CANTT 61-125) Number of domains in family: 232 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=PUTATIVE FULL=L-SERINE LYASE UNCHARACTERIZED EC=4.3.1.19 EC=4.3.1.17 BETA FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT Length = 65 Score = 104 (44.7 bits), Expect = 0.002 Identities = 22/62 (35%), Positives = 37/62 (59%), Gaps = 1/62 (1%)
 Query:     71 VIAASAGNHAQGVAISAKKFDTKAIIVMPESTPLLKVSATKSLGAEVILKGDNFDEAYAF 130
               + ++S GN     A ++K F  K  +V+PES+    +   KSLGA+VI+ G ++ EA ++
 Sbjct:     64 IFSSSGGNAGLAAAYASKYFGLKCTVVLPESSKPTVIEKLKSLGAKVIVHGKHWGEADSY 123

 Query:    131 AT 132
                T
 Sbjct:    124 LT 125

>PDB0H2L1 (Closest domain: Q4L3B9_STAHJ 61-149) Number of domains in family: 57 Commentary (automatic): SUBNAME: FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT DEHYDRATASE BETA SUBUNIT FULL=THREONINE SYNTHASE FULL=CYSTEINE BIOSYNTHESIS LYASE Length = 89 Score = 103 (44.3 bits), Expect = 0.003 Identities = 26/81 (32%), Positives = 45/81 (55%), Gaps = 2/81 (2%)
 Query:     71 VIAASAGNHAQGVAISAKKFDTKAIIVMPESTPLLKVSATKSLGAEV--ILKGDNFDEAY 128
               ++ A+AGN   G+ I+A ++  K +I  PE     K+S  ++LGA++    K +    A 
 Sbjct:     62 IVEATAGNTGIGLVIAANRYHLKCVIFAPEGFSEEKISIMRALGADIKHTPKDEGMIGAQ 121

 Query:    129 AFATNYAKENGLSFIHPFEDE 149
                 A +YA+E G  +++ FE E
 Sbjct:    122 TKARSYAQEYGAVYMNQFETE 142

>PDC653O7 (Closest domain: A6LTQ6_CLOB8 37-65) Number of domains in family: 155 Commentary (automatic): SUBNAME: DEHYDRATASE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA SUBUNIT LYASE FULL=THREONINE FULL=PUTATIVE DEPENDENT FULL=PYRIDOXAL-PHOSPHATE Length = 29 Score = 102 (43.9 bits), Expect = 0.002 Identities = 20/29 (68%), Positives = 22/29 (75%), Gaps = 2/29 (6%)
 Query:     37 VYLKNENLQITGAYKIRGAYNKIANLDPE 65
               VY K EN+Q TGAYKIRGAY KI+ L  E
 Sbjct:     37 VYFKPENMQKTGAYKIRGAYYKISTLSEE 65

>PD925716 (Closest domain: Q4A0K4_STAS1 61-112) Number of domains in family: 3520 Commentary (automatic): BIOSYNTHESIS SYNTHASE FULL=CYSTEINE EC=2.5.1.47 TRANSFERASE RECNAME: CYSTEINE AMINO-ACID SUBNAME: LYASE Length = 52 Score = 100 (43.1 bits), Expect = 0.005 Identities = 24/48 (50%), Positives = 30/48 (62%), Gaps = 4/48 (8%)
 Query:     71 VIAASAGNHAQGVAISAKKFDTKAIIVMPESTPLLKVSATKSLGAEVI 118
               V+ ASAGN   GVAI+A  +   A+I  PE     K+S  K+LGAEVI
 Sbjct:     62 VVEASAGNTGIGVAIAANHYGVSAVIFAPEGFSEEKISIIKALGAEVI 109