Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PDC6O011 score=186 PDC6N9Z2 score=237 PD462779 score=114 PDB0A1S2 score=190


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PDC6N9Z2
PDB0A1S2
PDC6O011
PD462779
PDB72194



HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(139 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

      1-35  #PDC6O011                                            186 2e-16
     2-135  #PD462779                                            114 2e-05
    30-135  #PDB72194                                            105 0.0001
     36-84  #PDC6N9Z2                                            237 7e-24
   101-138  #PDB0A1S2                                            190 5e-17


>PDC6N9Z2 (Closest domain: G8V6H3_STAAU 100-156)
Number of domains in family: 21
Commentary (automatic):
SUBNAME: FULL=PUTATIVE UNCHARACTERIZED MEMBRANE FULL=MEMBRANE FULL=TRUNCATED FULL=HYPOTHETICAL REFERENCE SA0284 PROTEIN  
Length = 57
Score = 237  (95.9 bits), Expect = 7e-24
Identities = 48/49 (97%), Positives = 49/49 (100%)

 Query:     36 KSEYNAVESLRINIEIAKYKGIISLIVAIVLTVLMTLKSTPQITAETRD 84
               KSEYN+VESLRINIEIAKYKGIISLIVAIVLTVLMTLKSTPQITAETRD
 Sbjct:    100 KSEYNSVESLRINIEIAKYKGIISLIVAIVLTVLMTLKSTPQITAETRD 148

>PDB0A1S2 (Closest domain: D8HED3_STAAF 165-202) Number of domains in family: 20 Commentary (automatic): SUBNAME: FULL=PUTATIVE UNCHARACTERIZED MEMBRANE FULL=MEMBRANE FULL=HYPOTHETICAL REFERENCE SA0284 PROTEIN MW0271 Length = 38 Score = 190 (77.8 bits), Expect = 5e-17 Identities = 38/38 (100%), Positives = 38/38 (100%)
 Query:    101 AVWDLIIRVRKGTFAFVVIRPILFSCWLFILNMILSRL 138
               AVWDLIIRVRKGTFAFVVIRPILFSCWLFILNMILSRL
 Sbjct:    165 AVWDLIIRVRKGTFAFVVIRPILFSCWLFILNMILSRL 202

>PDC6O011 (Closest domain: Q2YVC7_STAAB 13-58) Number of domains in family: 21 Commentary (automatic): SUBNAME: FULL=PUTATIVE UNCHARACTERIZED MEMBRANE FULL=MEMBRANE FULL=CONSERVED FULL=HYPOTHETICAL REFERENCE SA0284 PROTEIN Length = 46 Score = 186 (76.3 bits), Expect = 2e-16 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Query:      1 MGSLFYAWMAFRNIWNRPLLLKYKNITDSSSGIVN 35
               MGSLFYAWMAFRNIWNRPLLLKYKNITDSSSGIVN
 Sbjct:     24 MGSLFYAWMAFRNIWNRPLLLKYKNITDSSSGIVN 58

>PD462779 (Closest domain: G8R9K1_STAAU 17-194) Number of domains in family: 39 Commentary (automatic): SUBNAME: FULL=PUTATIVE UNCHARACTERIZED MEMBRANE FULL=HYPOTHETICAL PLASMID FULL=CONSERVED REFERENCE Length = 178 Score = 114 (48.5 bits), Expect = 2e-05 Identities = 31/137 (22%), Positives = 63/137 (45%), Gaps = 12/137 (8%)
 Query:      2 GSLFYAWMAFRNIWNRPLLLKY---KNITDSSSGIVNKSEYNAVESLRINIEIAKYKGII 58
               GS  Y + A +++W +P L+ Y   K I +S          + +E   ++++ +K +GI 
 Sbjct:     67 GSFVYMYYAIKSLWVKPKLVNYIIAKEIGESK---------DVIEEQELDLQTSKIRGIY 117

 Query:     59 SLIVAIVLTVLMTLKSTPQITAETRDXXXXXXXXXXXXXXXXAVWDLIIRVRKGTFAFVV 118
                 I+AI + ++  L+  P++ A+                    V D+  + + G F F  
 Sbjct:    118 FFIIAIAMLIITKLRMQPELQADAISMNPVFIFIGVIIILIWLVLDIYRKKKYGIFLFKT 177

 Query:    119 IRPILFSCWLFILNMIL 135
               I P++ + W+ I  ++L
 Sbjct:    178 IVPLVVTTWIIIATIVL 194

>PDB72194 (Closest domain: F8KHW7_STALN 92-199) Number of domains in family: 4 Commentary (automatic): SUBNAME: MEMBRANE FULL=CONSERVED FULL=HYPOTHETICAL FULL=SIMILARITY FULL=PUTATIVE UNCHARACTERIZED Length = 108 Score = 105 (45.1 bits), Expect = 0.0001 Identities = 28/106 (26%), Positives = 54/106 (50%), Gaps = 6/106 (5%)
 Query:     30 SSGIVNKSEYNAVESLRINIEIAKYKGIISLIVAIVLTVLMTLKSTPQITAETRDXXXXX 89
               S   +++ +Y  +ES++IN++++KY+  ISL V   L +   +  TP +     +     
 Sbjct:     94 SDQSISQWKYGQIESMKINLQLSKYRLYISLGVLAALFIAAKILVTPDMVDVIVEIVETL 153

 Query:     90 XXXXXXXXXXXAVWDLIIRVRKGTFAFVVIRPILFSCWLFILNMIL 135
                           V D+++ +R+G FAF+ I+P      LFI+ +I+
 Sbjct:    154 FIILFFVTIVFFVIDIVLWIRRGKFAFITIKP------LFIMALII 193