Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PDA1F9Q4 score=228 PDB00502 score=189 PDB005G3 score=188 PDA1F9O4 score=250 PD864105 score=182 PDC696J3 score=180 PDC636W1 score=192


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PDA1F9O4
PDA1F9Q4
PDC636W1
PDB00502
PDB005G3
PD864105
PDC696J3
PD477895

Domain 3D modelling using Swiss-Model

Domain IDBEGINEND 
PDA1F9O4
PDA1F9Q4
PDC636W1
PD864105

Domain 3D modelling using Geno3D

Domain IDBEGINEND 
PDA1F9O4
PDA1F9Q4
PDC636W1
PD864105


HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
_quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs_quot;,  Nucleic Acids Res. 25:3389-3402.

Query: unkwown
	(248 letters)

Database: prodom2010.1 multiple alignments
	45,292,438 sequences; 2,147,483,647 total letters



ProDom domains producing High-scoring Segment Pairs:

  Position  ProDom domain                                      Score E value

      3-47  #PDA1F9Q4                                            228 2e-21
     48-82  #PDB00502                                            189 4e-16
    83-118  #PDB005G3                                            188 6e-16
    87-117  #PD477895                                            161 2e-12
   119-168  #PDA1F9O4                                            250 1e-24
   169-203  #PD864105                                            182 4e-15
   202-243  #PDC696J3                                            180 8e-15
   206-244  #PDC636W1                                            192 2e-16


>PDA1F9O4 (Closest domain: D4UD14_STAAU 132-181)
Number of domains in family: 932
Commentary (automatic):
MEMBRANE LIPOPROTEIN CELL SUBNAME: FULL=PUTATIVE UNCHARACTERIZED PRECURSOR FLAGS: SIGNAL TANDEM  
Length = 50
Score = 250  (100.9 bits), Expect = 1e-24
Identities = 50/50 (100%), Positives = 50/50 (100%)

 Query:    119 MKNNKIILLDKVEDQKLKERIENFKFFGQYADFKSLKSYNHGDVSINSNV 168
               MKNNKIILLDKVEDQKLKERIENFKFFGQYADFKSLKSYNHGDVSINSNV
 Sbjct:    132 MKNNKIILLDKVEDQKLKERIENFKFFGQYADFKSLKSYNHGDVSINSNV 181

>PDA1F9Q4 (Closest domain: E5R7H0_STAAG 3-47) Number of domains in family: 885 Commentary (automatic): MEMBRANE LIPOPROTEIN CELL SUBNAME: FULL=PUTATIVE UNCHARACTERIZED PRECURSOR FLAGS: SIGNAL TANDEM Length = 45 Score = 228 (92.4 bits), Expect = 2e-21 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Query:      3 LSIFIIGCGKGNEIKEDAKEEQIKKSFAKTLDMYPIKNLEDLYDK 47
               LSIFIIGCGKGNEIKEDAKEEQIKKSFAKTLDMYPIKNLEDLYDK
 Sbjct:      3 LSIFIIGCGKGNEIKEDAKEEQIKKSFAKTLDMYPIKNLEDLYDK 47

>PDC636W1 (Closest domain: D0K8V5_STAAD 219-257) Number of domains in family: 830 Commentary (automatic): MEMBRANE LIPOPROTEIN CELL SUBNAME: FULL=PUTATIVE UNCHARACTERIZED PRECURSOR FLAGS: SIGNAL TANDEM Length = 39 Score = 192 (78.6 bits), Expect = 2e-16 Identities = 39/39 (100%), Positives = 39/39 (100%)
 Query:    206 DGDLKGSSVGYKKLEIDFSKEENSELSIVDSLNFQPAKN 244
               DGDLKGSSVGYKKLEIDFSKEENSELSIVDSLNFQPAKN
 Sbjct:    219 DGDLKGSSVGYKKLEIDFSKEENSELSIVDSLNFQPAKN 257

>PDB00502 (Closest domain: Y400_STAAN 61-95) Number of domains in family: 636 Commentary (automatic): MEMBRANE LIPOPROTEIN CELL SUBNAME: FULL=PUTATIVE UNCHARACTERIZED PRECURSOR FLAGS: SIGNAL TANDEM Length = 35 Score = 189 (77.4 bits), Expect = 4e-16 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Query:     48 EGYRDGEFKKGDKGMWTIYTDFAKSNRPGVLDNEG 82
               EGYRDGEFKKGDKGMWTIYTDFAKSNRPGVLDNEG
 Sbjct:     61 EGYRDGEFKKGDKGMWTIYTDFAKSNRPGVLDNEG 95

>PDB005G3 (Closest domain: C8MW18_STAAU 96-131) Number of domains in family: 152 Commentary (automatic): MEMBRANE LIPOPROTEIN CELL SUBNAME: FULL=PUTATIVE UNCHARACTERIZED TANDEM FULL=TANDEM PRECURSOR FULL=STAPHYLOCOCCAL Length = 36 Score = 188 (77.0 bits), Expect = 6e-16 Identities = 36/36 (100%), Positives = 36/36 (100%)
 Query:     83 MVLNLDRNTRTAKGYYFVDTIYDNHENSYSKNYRVE 118
               MVLNLDRNTRTAKGYYFVDTIYDNHENSYSKNYRVE
 Sbjct:     96 MVLNLDRNTRTAKGYYFVDTIYDNHENSYSKNYRVE 131

>PD864105 (Closest domain: D1QHA9_STAAU 182-216) Number of domains in family: 915 Commentary (automatic): MEMBRANE LIPOPROTEIN CELL SUBNAME: FULL=PUTATIVE UNCHARACTERIZED PRECURSOR FLAGS: SIGNAL TANDEM Length = 35 Score = 182 (74.7 bits), Expect = 4e-15 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 4/35 (11%)
 Query:    169 PSYDAKFKMSNKDENVKQLRSRYNIPTDKAPILKM 203
               PSYDAKFKMSNKDENVKQLRSRYNIPTDKAPILKM
 Sbjct:    182 PSYDAKFKMSNKDENVKQLRSRYNIPTDKAPILKM 216

>PDC696J3 (Closest domain: Y402_STAA8 215-256) Number of domains in family: 60 Commentary (automatic): MEMBRANE LIPOPROTEIN CELL SUBNAME: FULL=PUTATIVE UNCHARACTERIZED FULL=TANDEM FULL=LIPOPROTEIN TANDEM FULL=STAPHYLOCOCCAL Length = 42 Score = 180 (73.9 bits), Expect = 8e-15 Identities = 35/42 (83%), Positives = 39/42 (92%), Gaps = 4/42 (9%)
 Query:    202 KMHIDGDLKGSSVGYKKLEIDFSKEENSELSIVDSLNFQPAK 243
               KMHIDG+LKGSSVGYKKLEIDFSK   S+LS++DSLNFQPAK
 Sbjct:    215 KMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAK 256

>PD477895 (Closest domain: C5Q5B6_STAAU 110-140) Number of domains in family: 540 Commentary (automatic): MEMBRANE LIPOPROTEIN CELL SUBNAME: FULL=PUTATIVE UNCHARACTERIZED PRECURSOR FLAGS: SIGNAL TANDEM Length = 31 Score = 161 (66.6 bits), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%), Gaps = 4/31 (12%)
 Query:     87 LDRNTRTAKGYYFVDTIYDNHENSYSKNYRV 117
               LDRNTRTAKGYYFVDTIYDNHENSYSKNYRV
 Sbjct:    110 LDRNTRTAKGYYFVDTIYDNHENSYSKNYRV 140